KEGG   Staphylococcus aureus subsp. aureus FDAARGOS_5: X998_0411Help
Entry
X998_0411         CDS       T03492                                 

Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sauf  Staphylococcus aureus subsp. aureus FDAARGOS_5
Pathway
sauf00071  Fatty acid degradation
sauf00072  Synthesis and degradation of ketone bodies
sauf00280  Valine, leucine and isoleucine degradation
sauf00310  Lysine degradation
sauf00362  Benzoate degradation
sauf00380  Tryptophan metabolism
sauf00620  Pyruvate metabolism
sauf00630  Glyoxylate and dicarboxylate metabolism
sauf00640  Propanoate metabolism
sauf00650  Butanoate metabolism
sauf00900  Terpenoid backbone biosynthesis
sauf01100  Metabolic pathways
sauf01110  Biosynthesis of secondary metabolites
sauf01120  Microbial metabolism in diverse environments
sauf01130  Biosynthesis of antibiotics
sauf01200  Carbon metabolism
sauf01212  Fatty acid metabolism
sauf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    X998_0411
   00630 Glyoxylate and dicarboxylate metabolism
    X998_0411
   00640 Propanoate metabolism
    X998_0411
   00650 Butanoate metabolism
    X998_0411
  Lipid metabolism
   00071 Fatty acid degradation
    X998_0411
   00072 Synthesis and degradation of ketone bodies
    X998_0411
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X998_0411
   00310 Lysine degradation
    X998_0411
   00380 Tryptophan metabolism
    X998_0411
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X998_0411
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X998_0411
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    X998_0411
Enzymes [BR:sauf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X998_0411
Exosome [BR:sauf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X998_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHW66129
Position
complement(1953408..1954589)
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLAEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacggtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagcagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgtagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgattaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system