KEGG   Staphylococcus aureus subsp. aureus FDAARGOS_5: X998_1726Help
Entry
X998_1726         CDS       T03492                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sauf  Staphylococcus aureus subsp. aureus FDAARGOS_5
Pathway
sauf00430  Taurine and hypotaurine metabolism
sauf00620  Pyruvate metabolism
sauf00640  Propanoate metabolism
sauf00680  Methane metabolism
sauf01100  Metabolic pathways
sauf01120  Microbial metabolism in diverse environments
sauf01200  Carbon metabolism
Module
sauf_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sauf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X998_1726
   00640 Propanoate metabolism
    X998_1726
  09102 Energy metabolism
   00680 Methane metabolism
    X998_1726
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    X998_1726
Enzymes [BR:sauf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     X998_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AHW66217
UniProt: A0A0D1KAE8
Position
583819..585021
Genome map
AA seq 400 aa AA seqDB search
MSKLILAINAGSSSLKFQLIRMPEEELVTKGLVERIGLKDSIFTIEVNGEKVKTVQDIKD
HVEAVDIMLDAFKAHNIINDINDIDGTGHRVVHGGEKFPESVAITDEVEKEIEELSELAP
LHNPANLMGIRAFRKLLPNIPHVAIFDTAFHQTMPEKAYLYSLPYHYYKDYGIRKYGFHG
TSHKFVSQRAAEMLDKPIEDLRIISCHIGNGASIAAIDGGKSIDTSMGFTPLAGVTMGTR
SGNIDPALIPFIMEKTGKTAEQVLEILNKESGLLGLSGTSSDLRDLSEEAESGKARSQMA
LDVFASKIHKYIGSYAARMHGVDVIVFTAGIGENSVEIRAKVLEGLEFMGVYWDPKKNEN
LLRGKEGFINYPHSPVKVVVIPTDEESMIARDVMTFGGLK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattaatcttggctatcaatgctggtagttcatcattaaaatttcaattaatt
agaatgcctgaagaggaattagtaacaaaaggtttagtagaaagaatcggattgaaggat
tcaatttttacaattgaagtcaacggggaaaaagttaaaacagtacaagatatcaaggat
cacgttgaggcagttgatatcatgttggatgcttttaaagcgcacaatattattaatgat
attaacgatatcgatggaacaggtcaccgtgttgtacatggtggtgaaaaattccctgaa
tcagtagctattactgatgaggttgaaaaggaaattgaagaattaagcgaattagcaccg
cttcacaacccagctaacttgatgggtattcgtgctttccgtaaattattaccaaatatc
cctcatgtggcaatttttgatacagcattccatcaaacaatgcctgaaaaagcatatcta
tatagcttgccatatcattattataaagattatggcattcgtaagtatggtttccatggt
acaagccataaatttgtatcacaaagagcggcagaaatgttagataagccaattgaagat
ttacgtattatttcatgtcacattggtaatggagcatcaattgcagctatcgatggcggt
aaatctattgatacatcaatgggcttcacaccacttgctggtgtaacaatgggtactcgt
tctggtaatattgaccctgctttaattccatttattatggaaaaaacaggtaaaactgct
gaacaagtattggaaatcttaaacaaagaatcaggtttattaggattatcaggtacatct
agtgatttacgtgacttatcagaagaagctgaatcaggtaaagcacgttcacaaatggct
ttagatgtatttgcttctaaaattcacaaatatattggatcatatgctgcgagaatgcat
ggtgttgatgttatcgtatttacagcaggtatcggtgaaaactcagtagaaattcgtgcg
aaagttcttgaaggcttagaatttatgggtgtttactgggatcctaagaaaaatgaaaac
ttactacgtggtaaagaaggatttattaactatcctcattcaccagttaaagttgtcgtt
attccaacagatgaagaaagtatgattgcccgtgatgttatgacattcggtggtttaaaa
taa

DBGET integrated database retrieval system