KEGG   Staphylococcus aureus subsp. aureus FDAARGOS_5: X998_2098Help
Entry
X998_2098         CDS       T03492                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sauf  Staphylococcus aureus subsp. aureus FDAARGOS_5
Pathway
sauf00240  Pyrimidine metabolism
sauf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    X998_2098
Enzymes [BR:sauf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     X998_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_19
Motif
Other DBs
NCBI-ProteinID: AHW68308
UniProt: A0A0D1K100
Structure
PDB: 

Position
212988..213587
Genome map
AA seq 199 aa AA seqDB search
MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
PRCRAHHIVAPSDNNKEEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaacttaccattccggttggatagaatgtattacaggtagtatgtttagcggt
aaatccgaagaactaataagacgtctaagaaggggtatatacgctaaacaaaaagtcgtt
gtatttaaaccggcgattgatgatcgatatcataaagaaaaagtggtctctcataatggt
aatgccattgaagcgattaatatttctaaagcaagtgaaattatgacgcacgacttaact
aatgttgatgttataggaatagacgaagtgcaattttttgacgatgaaattgtaagtata
gtagaaaaactatcagcagatggacaccgtgttattgttgctggattagatatggatttt
aggggcgaaccgttcgaaccaatgcctaaattgatggctgtcagtgaacaagtaacgaaa
cttcaagcagtttgtgctgtttgtggttcttcatctagtagaacgcaacgattaataaat
ggtaaaccagctaaaatcgatgatccgattatcttagtaggtgccaatgaaagttatgag
ccacgttgtcgcgcgcaccatatcgtagcacctagtgataataataaggaggaattataa

DBGET integrated database retrieval system