KEGG   Staphylococcus aureus subsp. aureus SA268 (CA-MRSA): SA268_0323Help
Entry
SA268_0323        CDS       T03790                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saug  Staphylococcus aureus subsp. aureus SA268 (CA-MRSA)
Pathway
saug00071  Fatty acid degradation
saug00072  Synthesis and degradation of ketone bodies
saug00280  Valine, leucine and isoleucine degradation
saug00310  Lysine degradation
saug00362  Benzoate degradation
saug00380  Tryptophan metabolism
saug00620  Pyruvate metabolism
saug00630  Glyoxylate and dicarboxylate metabolism
saug00640  Propanoate metabolism
saug00650  Butanoate metabolism
saug00900  Terpenoid backbone biosynthesis
saug01100  Metabolic pathways
saug01110  Biosynthesis of secondary metabolites
saug01120  Microbial metabolism in diverse environments
saug01130  Biosynthesis of antibiotics
saug01200  Carbon metabolism
saug01212  Fatty acid metabolism
saug02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SA268_0323 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    SA268_0323 (thl)
   00640 Propanoate metabolism
    SA268_0323 (thl)
   00650 Butanoate metabolism
    SA268_0323 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SA268_0323 (thl)
   00072 Synthesis and degradation of ketone bodies
    SA268_0323 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SA268_0323 (thl)
   00310 Lysine degradation
    SA268_0323 (thl)
   00380 Tryptophan metabolism
    SA268_0323 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SA268_0323 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SA268_0323 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SA268_0323 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saug04147]
    SA268_0323 (thl)
Enzymes [BR:saug01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SA268_0323 (thl)
Exosome [BR:saug04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SA268_0323 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt BsuBI_PstI_RE
Motif
Other DBs
NCBI-ProteinID: AII54890
Position
371097..372278
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGESIVVTMDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagaacaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaatcaatcgttgtcactatggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagtcgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system