KEGG   Staphylococcus aureus subsp. aureus SA268 (CA-MRSA): SA268_0814Help
Entry
SA268_0814        CDS       T03790                                 

Gene name
dltA
Definition
(GenBank) D-alanine-D-alanyl carrier protein ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
saug  Staphylococcus aureus subsp. aureus SA268 (CA-MRSA)
Pathway
saug00473  D-Alanine metabolism
saug01100  Metabolic pathways
saug01503  Cationic antimicrobial peptide (CAMP) resistance
saug02020  Two-component system
saug05150  Staphylococcus aureus infection
Module
saug_M00725  Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon
Brite
KEGG Orthology (KO) [BR:saug00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SA268_0814 (dltA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SA268_0814 (dltA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    SA268_0814 (dltA)
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SA268_0814 (dltA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:saug01504]
    SA268_0814 (dltA)
Enzymes [BR:saug01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     SA268_0814 (dltA)
Antimicrobial resistance genes [BR:saug01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SA268_0814 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C NIR_SIR
Motif
Other DBs
NCBI-ProteinID: AII55381
Position
890199..891656
Genome map
AA seq 485 aa AA seqDB search
MTDIINKLQAFADTNPQSIAVRHTTDELTYQQLMDESSKLAHRLQGSKKPMILFGHMSPY
MIVGMIGAIKAGCGYVPVDTSIPEDRIKMIINKVQPEFVFNTTDESFESLEGEVFTIEDI
KTSQDPVIFDSQIKDNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELNKSGNEQQW
LNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMINKPKLLNEMLTATPINIWVSTPSFMEM
CLLLPTLNEEQYGSLNEFFFCGEILPHRAAKALVSRFPSATIYNTYGPTEATVAVTSIQI
TQEILDQYPTLPVGVERPGARLSTTDEGELVIEGQSVSLGYLKNDQKTAEVFNFDDGIRT
YHTGDKAKFENGQWFIQGRIDFQIKLNGYRMELEEIETQLRQSEFVKEAIVVPVYKNDKV
IHLIGAIVPTTEATDNAEMTKNIKNDLKSRLPEYMIPRKFEWMEQLPLTSNGKIDRKKIA
EVING
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacagatattattaacaagctgcaagcgtttgcggatacaaatccacaaagcattgct
gttagacacacaactgatgaattaacttatcaacagttaatggatgagtctagtaaatta
gcacatcgattacaaggtagtaagaaaccgatgattttattcggtcacatgtcaccatat
atgattgttgggatgattggtgccattaaagcaggatgtggatatgtacctgtagacact
tcaattcctgaagaccgtattaaaatgattattaacaaggttcaaccagagtttgtattt
aatacgactgatgaatcatttgaaagtttagaaggcgaagtatttacaatagaagatatt
aaaacatctcaagacccagtaatttttgatagtcagattaaagataacgacacagtatac
acaatctttacatctggttctactggggaacctaaaggtgttcaaattgaatatgcaagt
ttagttcaatttactgagtggatgttagaacttaataaatcaggaaatgaacaacaatgg
cttaaccaagcgccattttcatttgatttatctgtaatggctatttatccatgtttagca
tcaggcggtacattaaatcttgtagataaaaacatgattaataaacctaaattattaaat
gaaatgctaacagcaacaccgattaacatttgggtatcaacaccatcatttatggaaatg
tgtttattattaccaacgcttaatgaagaacagtatggtagtcttaacgaattcttcttc
tgtggtgaaattctacctcacagagcagcaaaagcgttagtaagccgtttcccaagtgcg
acgatttacaacacatatggtccaactgaagctacggtagcagttacaagtattcaaatt
acacaagaaatcttagatcaatatccgacattacctgttggcgttgaaagaccaggcgca
agattatctacgacagatgaaggtgaacttgttatcgaaggtcaaagtgtaagtttagga
tacttaaaaaatgaccaaaaaacagctgaagtatttaatttcgatgacggtattcgtact
tatcacactggtgataaagcgaagtttgaaaatggtcaatggttcattcaaggtcgtatt
gatttccaaatcaaattgaatggctacagaatggaattagaagaaattgaaacacaatta
cgccagtctgagttcgtaaaagaagcgattgttgtacctgtatataaaaatgataaagtt
attcatttaattggtgcaattgtgccaacgactgaagctacggacaatgcagaaatgact
aaaaatattaaaaatgacttgaaatcacgcttaccagagtatatgattcctagaaagttt
gaatggatggaacaattgccattaacttcaaatggtaaaattgacagaaagaaaattgca
gaggtaattaacggatga

DBGET integrated database retrieval system