KEGG   Staphylococcus aureus subsp. aureus SA268 (CA-MRSA): SA268_2147Help
Entry
SA268_2147        CDS       T03790                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
saug  Staphylococcus aureus subsp. aureus SA268 (CA-MRSA)
Pathway
saug03010  Ribosome
Brite
KEGG Orthology (KO) [BR:saug00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SA268_2147 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:saug03011]
    SA268_2147 (rplV)
Ribosome [BR:saug03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SA268_2147 (rplV)
  Bacteria
    SA268_2147 (rplV)
  Archaea
    SA268_2147 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: AII56714
Structure
PDB: 

Position
complement(2293911..2294264)
Genome map
AA seq 117 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaacaataagaatcgcacctcgtaaagtaagactagtt
cttgacttaatcagaggtaaaaatgctgctgaagctattgcaattttaaaattaacaaac
aaagcttcatcaccagtaattgaaaaagtattaatgtccgctttagctaatgctgaacat
aactatgacatgaacacagatgaattagtagttaaagaagcatatgctaacgaaggacca
acattaaaacgtttccgtccacgtgcgcaaggtcgtgcaagtgcgattaacaaacgtaca
agccacattacaatcgtcgtaagtgacggtaaagaagaagctaaagaagcttaa

DBGET integrated database retrieval system