KEGG   Staphylococcus aureus USA300-ISMMS1: AZ30_02910Help
Entry
AZ30_02910        CDS       T03115                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saui  Staphylococcus aureus USA300-ISMMS1
Pathway
saui00071  Fatty acid degradation
saui00072  Synthesis and degradation of ketone bodies
saui00280  Valine, leucine and isoleucine degradation
saui00310  Lysine degradation
saui00362  Benzoate degradation
saui00380  Tryptophan metabolism
saui00620  Pyruvate metabolism
saui00630  Glyoxylate and dicarboxylate metabolism
saui00640  Propanoate metabolism
saui00650  Butanoate metabolism
saui00900  Terpenoid backbone biosynthesis
saui01100  Metabolic pathways
saui01110  Biosynthesis of secondary metabolites
saui01120  Microbial metabolism in diverse environments
saui01130  Biosynthesis of antibiotics
saui01200  Carbon metabolism
saui01212  Fatty acid metabolism
saui02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZ30_02910
   00630 Glyoxylate and dicarboxylate metabolism
    AZ30_02910
   00640 Propanoate metabolism
    AZ30_02910
   00650 Butanoate metabolism
    AZ30_02910
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZ30_02910
   00072 Synthesis and degradation of ketone bodies
    AZ30_02910
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZ30_02910
   00310 Lysine degradation
    AZ30_02910
   00380 Tryptophan metabolism
    AZ30_02910
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZ30_02910
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZ30_02910
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZ30_02910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saui04147]
    AZ30_02910
Enzymes [BR:saui01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZ30_02910
Exosome [BR:saui04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZ30_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHJ06367
Position
641191..642330
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHILKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaaaaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattctgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system