KEGG   Staphylococcus aureus USA300-ISMMS1 (MRSA): AZ30_10655Help
Entry
AZ30_10655        CDS       T03115                                 

Definition
(GenBank) phosphodiesterase
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
saui  Staphylococcus aureus USA300-ISMMS1 (MRSA)
Pathway
saui00562  Inositol phosphate metabolism
saui00564  Glycerophospholipid metabolism
saui01100  Metabolic pathways
saui01110  Biosynthesis of secondary metabolites
saui02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:saui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AZ30_10655
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AZ30_10655
   00565 Ether lipid metabolism
    AZ30_10655
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AZ30_10655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:saui02042]
    AZ30_10655
Enzymes [BR:saui01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     AZ30_10655
Bacterial toxins [BR:saui02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   AZ30_10655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-ProteinID: AHJ07843
Structure
PDB: 

Position
2177075..2177944
Genome map
AA seq 289 aa AA seqDB search
MRDSKPNKYCCYKVSMYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVK
KEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDS
NKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDET
VYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYI
FTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
attagggactccaaacccaataaatactgttgttacaaggtttctatgtatccaaactgg
gggcaatataaacgcgctgatttaatcggacaatcttcttatattaaaaataatgatgtc
gtaatattcaatgaagcatttgataatggtgcatcagacaaattattaagtaatgtgaaa
aaagaatatccttatcaaacacctgtactcggccgttctcaatcagggtgggacaaaact
gaaggtagctactcatcaactgttgcagaagatggtggcgtagcgattgtaagtaaatat
cctattaaagaaaaaatccagcatgttttcaaaagcggttgtggattcgataatgatagc
aacaaaggctttgtttatacaaaaatagagaaaaatggtaagaacgttcacgttatcggt
acacatacacaatctgaagattcacgttgtggtgctggacatgatcgaaaaattagagct
gaacaaatgaaagaaatcagtgactttgttaaaaagaaaaatatccctaaagatgaaacg
gtatatataggtggcgaccttaatgtcaataaaggcactccagagttcaaagatatgctt
aaaaacttgaatgtaaatgatgttctatatgcaggtcataatagcacatgggaccctcaa
tcaaattcaattgcgaaatataattaccctaatggtaaaccagaacatttagactatata
tttacagataaagatcataaacaaccaaaacaattagtcaatgaagttgtgactgaaaaa
cctaagccatgggatgtatatgcgttcccatattactacgtttacaatgatttttcagat
cattacccaatcaaagcctatagtaaatag

DBGET integrated database retrieval system