KEGG   Staphylococcus aureus USA300-ISMMS1 (MRSA): AZ30_13700Help
Entry
AZ30_13700        CDS       T03115                                 

Definition
(GenBank) precorrin-2 dehydrogenase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
saui  Staphylococcus aureus USA300-ISMMS1 (MRSA)
Pathway
saui00860  Porphyrin and chlorophyll metabolism
saui01100  Metabolic pathways
saui01110  Biosynthesis of secondary metabolites
saui01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saui00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AZ30_13700
Enzymes [BR:saui01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     AZ30_13700
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     AZ30_13700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M 2-Hacid_dh_C Pyr_redox Pyr_redox_2 Shikimate_DH BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AHJ08422
Position
complement(2809580..2810185)
Genome map
AA seq 201 aa AA seqDB search
MNMPLMIDLTNKNVVIVGGGVVASRRAQTLNQYVEHMTVISPTITEKLQNMVDNGVVIWK
EKEFEPSDIVDAYLVIAATNEPRVNEAVKKALPEHALFNNVGDASNGNVVFPSALHRDKL
TISVSTDGASPKLTKSIMAELEALYPPSYSSYIDFLYTCRQKIKVLDITYNEKQQLLSQI
VSQEYLNHDKQAQFLAWLDVR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgccattaatgatagatttaacaaataaaaatgtcgtcatagttggtggaggc
gtcgttgcaagtcgtcgggcacaaacattaaatcaatacgttgaacatatgacggtcatc
agtccgacaatcactgaaaaacttcaaaatatggtagataacggtgtcgtcatatggaaa
gaaaaagaatttgaaccaagcgatattgtagacgcgtatctagttattgcagcaaccaat
gagccacgtgtcaatgaagcggtaaaaaaagccttacctgagcatgccctttttaataat
gttggagatgcatcaaatggcaatgttgtatttccaagtgcactacaccgcgacaagcta
actatcagtgtatcaactgatggtgcgagtcctaagttgacaaaatcaattatggcagag
cttgaggcgttatatccaccatcatacagttcgtatatcgactttttatatacttgccga
cagaaaataaaagtacttgatataacatataacgaaaagcaacagttactgtcacaaatt
gtgtcacaagaatatttaaatcatgacaaacaagctcaatttttagcgtggttggatgta
agataa

DBGET integrated database retrieval system