KEGG   Staphylococcus aureus subsp. aureus ST228/10497 (MRSA): SAI2T2_1001560Help
Entry
SAI2T2_1001560    CDS       T03144                                 

Definition
(GenBank) Similar to gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sauj  Staphylococcus aureus subsp. aureus ST228/10497 (MRSA)
Pathway
sauj00430  Taurine and hypotaurine metabolism
sauj00460  Cyanoamino acid metabolism
sauj00480  Glutathione metabolism
sauj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SAI2T2_1001560
   00460 Cyanoamino acid metabolism
    SAI2T2_1001560
   00480 Glutathione metabolism
    SAI2T2_1001560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sauj01002]
    SAI2T2_1001560
Enzymes [BR:sauj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     SAI2T2_1001560
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     SAI2T2_1001560
Peptidases and inhibitors [BR:sauj01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   SAI2T2_1001560
CD molecules [BR:sauj04090]
 Proteins
  SAI2T2_1001560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: CCJ12101
Position
215215..217221
Genome map
AA seq 668 aa AA seqDB search
MVINLNDKQTKTSKEGLISVSHPLAAKIGKDVLDQGGNAMDAVIAIQLALNVVEPFASGI
GGGGYLLYYEQSTGSITAFDARETAPEHVDKQFYLDDSGEYKSFFDMTTHGKTVAVPAIP
KLFDYIHKRYAKLSLEDLINPAIELAIEGHAANWATEKYSRQQHARLTKYHETAQVFTHE
NQYWREGDWIVQPELGKTFQILREQGFNAFYKGDIAKQLVNVVKACGGTIILEDLANYDI
QIKAPISATFKDYDIYSMGPSSSGGITVIQILKLLEHVDLPSMGPRSVDYLHHLIQAMHL
AYSDRAQYLADDNFHEVPVQSLIDDDYLKARSTLINSNKANIDIEHGVVSDCISHTDVEE
NHTETTHFCVIDKEGNIASFTTSIGMIYGSGITIPGYGVLLNTTMDGFDVVDGGINEIAP
YKRPLSNMAPTIVMHHGKPILTVGAPGAISIIASVAQTLINVLVFGMDIQQAIDEPRIYS
SHPNRIEWEPQFSQSTILALIARGHAMEHKPDAYIGDVHGLQVDLNTRDASGGADDTREG
TVIGGDVLSIRKQPLPSPKIYDNDTHRVYFNDMQLPLYAEQVRWMHDKYWVDESVIRIIF
PEVSVHIEDLRSYEIAGKNYIDIAWLARKKGYQVTLKDDSLYLTDETYHSVKANTNAYYR
YDRDSITR
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggtcattaacttaaatgacaaacagacaaaaacatctaaagaagggttaatttccgta
tcacatcctcttgcggctaaaattggtaaggatgtattagatcaaggtggcaacgccatg
gatgccgtgattgcaattcaactggcattgaatgtggtagaaccatttgcatcaggtatt
ggtggtggcgggtacttgctatattatgagcaaagtactggcagtataactgcgtttgat
gcacgtgagacagcacctgaacatgtagacaaacaattttatctagatgattcaggcgaa
tataaatcattttttgatatgactacacatggtaaaactgtcgctgtgccagcaattcca
aagctgtttgattatattcacaagcgttatgctaaattgtcattggaagatttaattaat
cctgcaattgaactagccattgaaggtcatgcagccaattgggctactgaaaaatattcg
cgccagcaacacgcacgattgacaaagtatcatgaaacggcacaagtatttacgcatgaa
aatcaatattggcgtgaaggtgattggattgtacaacccgaattaggtaagacatttcaa
atattaagagaacaagggtttaatgcattttataaaggtgacattgcgaaacaattagtc
aatgttgttaaagcatgtggtgggacaatcattttagaggatctagccaattatgacatt
cagattaaagcgccaatcagtgcgacatttaaagactatgacatttattcaatgggacca
tctagttctggcggtatcacggtcattcaaatattgaagttattagaacatgtcgattta
ccatctatgggtccaagatctgtcgattacttgcatcatttgatacaagcgatgcattta
gcatatagtgatcgcgcgcaatacttggcggatgataattttcatgaggtgcctgtacag
tcattaattgatgacgattatttaaaagcacgcagtacgctcattaatagcaataaagca
aatattgatatagagcatggtgttgtgtctgattgcattagtcatacagatgttgaagaa
aatcataccgaaacaactcatttttgtgtgattgataaggaaggtaatattgcttcattt
acgacatcaattggtatgatttatggttcaggtatcacgattccaggctacggtgtgtta
ttgaatacgacaatggatggctttgatgtagtagatggtggtattaacgaaattgcacca
tataaacgaccactaagtaacatggctccaacgattgtgatgcatcacgggaagccgata
ttaacagtaggtgcacctggtgccataagtatcattgctagtgttgcgcaaacattaatc
aatgtattagtgtttggcatggatattcagcaggctatagatgaacctagaatttatagt
agccatcctaatcgcattgaatgggagcctcaattttcacaatctacaatattagcattg
attgcacgtggacatgcaatggaacataaaccagatgcctatattggagatgtacatggg
ttacaggttgacttgaatacacgtgacgcgtcgggaggtgctgatgatacgagggaaggc
acagtgataggtggcgatgtattatcaattagaaaacaaccattacctagtccgaaaata
tacgataatgacacccatcgagtatatttcaatgatatgcagttgccattatatgctgaa
caagtgcggtggatgcatgacaaatattgggttgatgaaagtgttattagaatcattttc
cctgaagttagtgtgcatattgaagatttaagaagttatgaaatcgccggaaaaaattat
atagatattgcctggttggcacggaagaaaggttatcaagttaccttaaaggatgacagt
ttatacttaactgatgaaacatatcattcagtgaaagcaaacacaaatgcatactataga
tatgatcgagatagtatcacaagataa

DBGET integrated database retrieval system