KEGG   Staphylococcus aureus subsp. aureus ST228/10497 (MRSA): SAI2T2_1008210Help
Entry
SAI2T2_1008210    CDS       T03144                                 

Gene name
murI
Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
sauj  Staphylococcus aureus subsp. aureus ST228/10497 (MRSA)
Pathway
sauj00471  D-Glutamine and D-glutamate metabolism
sauj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SAI2T2_1008210 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sauj01011]
    SAI2T2_1008210 (murI)
Enzymes [BR:sauj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SAI2T2_1008210 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:sauj01011]
 Precursor biosynthesis
  Racemase
   SAI2T2_1008210 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: CCJ12746
Structure
PDB: 

Position
1109452..1110252
Genome map
AA seq 266 aa AA seqDB search
MNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIGRCPYGPRPGEQVKQYTVEIARKL
MEFDIKMLVIACNTATAVALEYLQKTLSIPVIGVIEPGARTAIMTTRNQNVLVLGTEGTI
KSEAYRTHIKRINPHVEVHGVACPGFVPLVEQMRYSDPTITSIVIHQTLKRWRNSESDTV
ILGCTHYPLLYKPIYDYFGGKKTVISSGLETAREVSALLTFSNEHASYTEHPDHRFFATG
DPTHITNIIKEWLNLSVNVERISVND
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccaataggtgtaatagactctggtgtcggaggtttgacagtagctaaagaa
attatgcgtcagttgccaaatgagacgatttattacttaggtgatattggacgatgtcca
tatgggccaagaccaggagaacaagtaaaacaatatacagttgaaatcgctcgtaaatta
atggaatttgatataaaaatgctcgtgattgcttgtaatacagcaactgctgtagcttta
gaatatttacaaaagaccttatcaatcccagtgattggtgtaattgaaccaggtgctaga
acagcaataatgactactagaaatcaaaatgtattagtactaggaactgaaggcacaatt
aaatctgaagcatatcgtacgcatattaaacgtatcaatccacatgtagaggtacatggc
gttgcctgtccaggttttgtgccacttgtagaacaaatgagatatagtgatccaacaatt
acaagcattgtcattcatcaaacactgaaacgttggcgtaatagtgagtctgatactgtc
attttaggatgtacccactatccattgctctataaacctatctatgattattttggtggt
aaaaagacagtgatttcgtctggattagaaacggctcgtgaagttagtgcattgctaaca
tttagtaatgaacatgcaagttatactgaacatccagatcatcgattttttgcaacaggt
gatcctactcacattactaacattatcaaagagtggttaaatttatctgtcaatgtggaa
cgtatatcagtgaatgactag

DBGET integrated database retrieval system