KEGG   Staphylococcus aureus subsp. aureus ST228/10497 (MRSA): SAI2T2_1013700Help
Entry
SAI2T2_1013700    CDS       T03144                                 

Definition
(GenBank) Putative uncharacterized protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sauj  Staphylococcus aureus subsp. aureus ST228/10497 (MRSA)
Brite
KEGG Orthology (KO) [BR:sauj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sauj03009]
    SAI2T2_1013700
Enzymes [BR:sauj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SAI2T2_1013700
Ribosome biogenesis [BR:sauj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SAI2T2_1013700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CCJ13286
Position
1882626..1883447
Genome map
AA seq 273 aa AA seqDB search
MKFKIPENFNDLSLRDIFQQLKVPKKDLHHLNMSKDITINDKPARLMDKVHTGDDVFVPT
IDEKSNYVPSYRYAQIKYEDDDMAIVMKPKGVKTHPNDLKESNTLMNHVIYTIDSDYVEP
IHRLDQETVGLLIVAKNPLMKKILDRMLEDNDITRIYKANVKALLPLKPQTIDMPIGKDK
FHSNKRRVSPTGQRAITHILTSKMIKEAVCQLEIKLDTGRTHQIRVHLAEIGHPVIGDPL
YGDSTLRQLELESYKIEFVHPLTKEVISVSLDD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaaaataccagaaaactttaatgacttaagtttacgagatattttccaacaa
cttaaggtacctaaaaaagatttacatcatttaaatatgtctaaagatattactattaat
gataaacctgcgcgattaatggataaagtgcatactggcgacgatgtatttgttccaacc
atcgatgaaaaaagtaattatgttccaagttatcgttatgcacaaattaaatacgaagac
gatgatatggcaatcgtaatgaaacctaaaggtgttaagactcaccctaatgatttaaaa
gaaagcaatactttaatgaatcatgtgatttacactattgatagtgactatgtcgaacca
attcatcgactggaccaggaaacagtaggattattaattgttgctaaaaatcctttaatg
aaaaaaattcttgatcgcatgttagaagacaatgatattacgcggatatacaaagcaaat
gttaaggcacttttacctttaaaaccacaaacgattgatatgccaattggtaaagataaa
ttccattcgaataaacgacgtgtgtctcctactggacagcgtgcaattacacacatttta
acttcaaaaatgataaaagaagctgtgtgccaacttgaaatcaagttggatactggacgt
actcatcaaattcgtgtgcatttagctgaaattggtcaccctgttattggtgatccttta
tatggtgattcaacgttaagacaattagaacttgaaagttacaaaatagagtttgtgcat
cccttgactaaggaagtcatttccgtttctttggatgactaa

DBGET integrated database retrieval system