KEGG   Staphylococcus aureus subsp. aureus ST228/10497 (MRSA): SAI2T2_1019600Help
Entry
SAI2T2_1019600    CDS       T03144                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sauj  Staphylococcus aureus subsp. aureus ST228/10497 (MRSA)
Pathway
sauj00480  Glutathione metabolism
sauj00590  Arachidonic acid metabolism
sauj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SAI2T2_1019600
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAI2T2_1019600
Enzymes [BR:sauj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SAI2T2_1019600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF2691 AHJR-like
Motif
Other DBs
NCBI-ProteinID: CCJ13834
Position
complement(2652948..2653445)
Genome map
AA seq 165 aa AA seqDB search
MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagaaatgtgtatgatatcgaagtaagtgattataaaggcttaacttataaa
ttagaagcatttagaggtaaagtgattttagttgttaatactgcaacagaatgtatatat
agcgaacaattgaaaaaactagagactttgtttcaaaaatataaggatcgtgggtttgta
gtgttgagttttccgaataataattttgacaatcgacaaccaggttctaatgaagaaatc
ttgaaaattagtcgtgagaaatttggtgttacatttccagtgctagctaaaatatctgtg
aacgggaacgatgaacatccgttatttacgcatttaaagaatgaacaaccaggaatcttt
gggtccccaataaaatggaatttcacaaaatttataatcgatcgacaaggcaatgttgta
aatcgattcttgccaatggaagatccattggatatatcgacaaatatagaaatattattg
caagaatcttcatcttaa

DBGET integrated database retrieval system