KEGG   Staphylococcus aureus subsp. aureus ST228/15532 (MRSA): SAI3T3_1002720Help
Entry
SAI3T3_1002720    CDS       T03145                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sauk  Staphylococcus aureus subsp. aureus ST228/15532 (MRSA)
Pathway
sauk00071  Fatty acid degradation
sauk00072  Synthesis and degradation of ketone bodies
sauk00280  Valine, leucine and isoleucine degradation
sauk00310  Lysine degradation
sauk00362  Benzoate degradation
sauk00380  Tryptophan metabolism
sauk00620  Pyruvate metabolism
sauk00630  Glyoxylate and dicarboxylate metabolism
sauk00640  Propanoate metabolism
sauk00650  Butanoate metabolism
sauk00900  Terpenoid backbone biosynthesis
sauk01100  Metabolic pathways
sauk01110  Biosynthesis of secondary metabolites
sauk01120  Microbial metabolism in diverse environments
sauk01130  Biosynthesis of antibiotics
sauk01200  Carbon metabolism
sauk01212  Fatty acid metabolism
sauk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAI3T3_1002720
   00630 Glyoxylate and dicarboxylate metabolism
    SAI3T3_1002720
   00640 Propanoate metabolism
    SAI3T3_1002720
   00650 Butanoate metabolism
    SAI3T3_1002720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAI3T3_1002720
   00072 Synthesis and degradation of ketone bodies
    SAI3T3_1002720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI3T3_1002720
   00310 Lysine degradation
    SAI3T3_1002720
   00380 Tryptophan metabolism
    SAI3T3_1002720
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAI3T3_1002720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAI3T3_1002720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAI3T3_1002720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauk04147]
    SAI3T3_1002720
Enzymes [BR:sauk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAI3T3_1002720
Exosome [BR:sauk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAI3T3_1002720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: CCJ14182
Position
374423..375604
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQHKAVCAQQNGEFDSEIVPVSIPQRKGEPILVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQLLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcag
tcaccaatgcttgtcaacaacagtcgcttcggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacataaagcagtatgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcttagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgcttaagaccagctttcaaaaaagacggg
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggcgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaattattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system