KEGG   Staphylococcus aureus subsp. aureus ST228/15532 (MRSA): SAI3T3_1017530Help
Entry
SAI3T3_1017530    CDS       T03145                                 

Gene name
mqo1
Definition
(GenBank) Probable malate:quinone oxidoreductase 1
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sauk  Staphylococcus aureus subsp. aureus ST228/15532 (MRSA)
Pathway
sauk00020  Citrate cycle (TCA cycle)
sauk00620  Pyruvate metabolism
sauk01100  Metabolic pathways
sauk01110  Biosynthesis of secondary metabolites
sauk01120  Microbial metabolism in diverse environments
sauk01130  Biosynthesis of antibiotics
sauk01200  Carbon metabolism
Module
sauk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sauk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sauk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAI3T3_1017530 (mqo1)
   00620 Pyruvate metabolism
    SAI3T3_1017530 (mqo1)
Enzymes [BR:sauk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SAI3T3_1017530 (mqo1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 HI0933_like
Motif
Other DBs
NCBI-ProteinID: CCJ15592
Position
complement(2370375..2371910)
Genome map
AA seq 511 aa AA seqDB search
MSYFSNVPLFILKRGTVFVMTTQHSKTDVILIGGGIMSATLGTLLKELSPEKNIKVFEKL
AQPGEESSNVWNNAGTGHSALCELNYTKEGKDGTVDCSKAIKINEQYQISKQFWAYLVKT
GQLDNPDRFIQAVPHMSFVIGEDNVAFIKSRVATLKKSVLFEKMKLSQDEEEMKSWVPLM
IEGRKSDEPIALTYDETGTDVNFGALTAKLFENLEQRGVGIQYKQNVLDIKKQKSGAWLV
KVKDLETNETTTYESDFVFIGAGGASLPLLQKTGIKQSKHIGGFPVSGLFLRCTNQEVID
RHHAKVYGKAAVGAPPMSVPHLDTRFVDGKRSLLFGPFAGFSPKFLKTGSHMDLIKSVKP
NNIVTMLSAGIKEMSLTKYLVSQLMLSNDERMDDLRVFFPNAKNEDWEVITAGQRVQVIK
DTEDSKGNLQFGTEVITSDDGTLAALLGASPGASTAVDIMFDVLQRCYRDEFKGWEPKIK
EMVPSFGYRLTDHEDLYHKINEEVTKYLQVK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatttctcgaacgttccattattcattttaaaaagggggactgtatttgttatg
acaacacaacatagcaaaacagatgtcatcttaattggtggcggtattatgagtgcaaca
ttaggaacattacttaaagaattatcacctgagaaaaatattaaagtgtttgaaaaatta
gcacaacctggcgaagagagttcaaatgtatggaataatgccggtacagggcattcagca
ctttgcgagttgaactatacaaaagaaggtaaggatggcacagttgattgtagtaaagca
attaagataaatgagcagtaccaaatttcaaaacagttttgggcatatttagttaaaaca
ggacaattagataacccagatcgctttattcaagcggtgccacacatgagttttgtcatt
ggcgaagataatgtagcttttataaaaagtcgtgttgcaacgttaaagaaaagtgtttta
ttcgaaaaaatgaaattatcgcaagatgaagaagaaatgaaatcttgggtaccgttaatg
attgaaggtcgtaagtctgatgaaccaattgctttaacttatgatgaaactggtacagat
gttaactttggtgcgttaactgcaaagttatttgaaaatttagagcaacgtggtgtggga
attcaatataagcagaatgtattagacatcaagaaacagaaatctggggcatggctagtt
aaagttaaagatttagaaactaatgaaacgacaacatatgaatctgattttgtatttatt
ggtgctggcggtgcgagtttaccattactccaaaagactgggattaaacaatcaaaacat
attggtggtttcccagtaagtggattattcctgcgctgtacaaatcaagaagtgattgat
cgtcatcatgctaaagtgtacggaaaagcagcagtgggtgcgccaccaatgtcagtgccg
cacttagatacacgttttgtagacggcaagcgttcattgttatttggtccatttgcaggt
ttctcacctaaatttttaaaaacaggttcacatatggatttaattaaatcggttaaacca
aataatatcgtgacgatgttatctgcaggtatcaaagaaatgagtcttacgaagtattta
gtgtcacaattgatgttatctaatgatgagcgtatggatgatttaagagtctttttccca
aatgctaaaaatgaagattgggaagtgattacagcagggcaacgtgtccaagtaatcaag
gatactgaggattctaaaggtaacttacaatttggtaccgaagtcattacgtcagatgat
ggcacattagctgcattacttggtgcatcacctggtgcgtcaacagctgtagatattatg
tttgatgttttacagcgatgctatcgtgatgaattcaaagggtgggaaccaaagattaaa
gaaatggtgccgtcatttggttatcgcttaacagatcatgaggatttatatcacaaaatt
aatgaagaagtaactaagtatttacaagttaaataa

DBGET integrated database retrieval system