KEGG   Staphylococcus aureus M1: BN843_3600Help
Entry
BN843_3600        CDS       T02618                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase @ Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saum  Staphylococcus aureus M1
Pathway
saum00280  Valine, leucine and isoleucine degradation
saum00310  Lysine degradation
saum00362  Benzoate degradation
saum00380  Tryptophan metabolism
saum00620  Pyruvate metabolism
saum00630  Glyoxylate and dicarboxylate metabolism
saum00640  Propanoate metabolism
saum00650  Butanoate metabolism
saum00900  Terpenoid backbone biosynthesis
saum01100  Metabolic pathways
saum01110  Biosynthesis of secondary metabolites
saum01120  Microbial metabolism in diverse environments
saum01130  Biosynthesis of antibiotics
saum01200  Carbon metabolism
saum01212  Fatty acid metabolism
saum02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN843_3600
   00630 Glyoxylate and dicarboxylate metabolism
    BN843_3600
   00640 Propanoate metabolism
    BN843_3600
   00650 Butanoate metabolism
    BN843_3600
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN843_3600
   00072 Synthesis and degradation of ketone bodies
    BN843_3600
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN843_3600
   00310 Lysine degradation
    BN843_3600
   00380 Tryptophan metabolism
    BN843_3600
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN843_3600
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN843_3600
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN843_3600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saum04147]
    BN843_3600
Enzymes [BR:saum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN843_3600
Exosome [BR:saum04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN843_3600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: CCW20704
Position
402618..403799
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacggtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgtagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgattaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacatcctattggtgcatctggtgctagagtattagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system