KEGG   Staphylococcus aureus M1 (MRSA): BN843_5230Help
Entry
BN843_5230        CDS       T02618                                 

Definition
(GenBank) Cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
saum  Staphylococcus aureus M1 (MRSA)
Pathway
saum00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:saum00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN843_5230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:saum01007]
    BN843_5230
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:saum03016]
    BN843_5230
Enzymes [BR:saum01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     BN843_5230
Amino acid related enzymes [BR:saum01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BN843_5230
Transfer RNA biogenesis [BR:saum03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BN843_5230
 Prokaryotic Type
    BN843_5230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f UVR PP2C_C
Motif
Other DBs
NCBI-ProteinID: CCW20857
Position
573529..574929
Genome map
AA seq 466 aa AA seqDB search
MITLYNTLTRQKEVFKPIEPGKVKMYVCGPTVYNYIHIGNARPAINYDVVRRYFEYQGYN
VEYVSNFTDVDDKLIKRSQELNQSVPEIAEKYIAAFHEDVGALNVRKATSNPRVMDHMDD
IIQFIKDLVDQGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLKVGARIDAGEHKEDALDF
TLWKKAKPGEISWDSPFGEGRPGWHIECSVMAFHELGPTIDIHAGGSDLQFPHHENEIAQ
SEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIKEVDPDVLRFFMISVHYRSP
INYNLELVESARSGLERIRNSYQLIEERAQIATNIENQQTYIDQIDAILNRFETVMNDDF
NTANAITAWYDLAKLANKYVLENTTSTEVIDKFKAVYQIFSDVLGVPLKSKNADELLDED
VEKLIEERNEARKNKDFARADEIRDMLKSQNIILEDTPQGVRFKRG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgattacattatataatacgcttacacgtcaaaaagaagtgttcaagcctatagaacca
gggaaagtaaaaatgtatgtatgtggtcctactgtatataactacattcatattggtaac
gcaagaccagcaattaattatgacgtagtgagacgttactttgaataccaaggatataat
gtagaatatgtatcaaattttacagacgtagatgataaattaattaaacgttctcaagaa
ttaaatcagtctgttcccgaaattgcagaaaaatatatcgctgcttttcatgaagatgtt
ggtgcgttaaatgttagaaaagcgacttcaaatccaagggtaatggaccatatggatgac
attattcaatttattaaagatttggtggatcaaggttatgcatatgaaagtggtggcgat
gtttactttagaacacgtaaatttgaaggttatggtaaattaagtcatcaatccatagat
gacttaaaagtgggtgctcgtatagatgcaggagagcataaagaagatgcacttgatttt
acattgtggaaaaaagcgaagcctggcgagattagttgggatagcccatttggtgaaggt
agaccaggatggcatatagaatgttctgtaatggcatttcatgagctaggacctacaatt
gatatacatgcgggtggttcagatttacaatttccacatcatgaaaatgaaatagcacaa
tcagaagcacataatcatgcgccatttgctaattattggatgcataatggtttcattaat
attgataatgaaaaaatgagtaaatcactaggcaactttattttagttcacgatattatt
aaagaagttgatccagatgtactaagattctttatgattagcgtacattatagaagccca
attaactataatctagaattggtagaatcagcacgtagtggactagagcgtattcgcaat
agttatcaattaattgaagagcgcgcacaaattgctactaatattgaaaatcaacagaca
tatattgatcaaattgatgcgattttaaatcgttttgaaacagttatgaatgatgatttt
aatacagctaatgcaattacagcttggtatgatttagcaaaacttgcgaataaatatgta
ctagagaacacaacatcaacagaagtaattgataaatttaaagcagtttatcaaattttc
agcgatgttttaggtgtaccgttaaaatctaaaaatgcagatgaattattggatgaagat
gttgaaaaattaatcgaagagcgtaatgaagcaaggaaaaacaaagattttgcacgagca
gatgaaattcgagacatgctgaaatcacaaaacattatattagaagacacacctcaaggg
gttagatttaaacgtggataa

DBGET integrated database retrieval system