KEGG   Staphylococcus aureus M1 (MRSA): BN843_7020Help
Entry
BN843_7020        CDS       T02618                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
saum  Staphylococcus aureus M1 (MRSA)
Pathway
saum00520  Amino sugar and nucleotide sugar metabolism
saum01100  Metabolic pathways
saum01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN843_7020
Enzymes [BR:saum01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BN843_7020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CCW21036
Position
757488..758669
Genome map
AA seq 393 aa AA seqDB search
MSELIIYNGKVYTEDGKIDNGYIHVKDGQIVAIGEVDDKAAIDNDTTNKIQVIDAKGHHV
LPGFIDIHIHGGYGQDAMDGSYDGLKYLSENLLSEGTTSYLATTMTQSTDKIDNALTNIA
KYEAEQDVHNAAEIVGIHLEGPFISENKVGAQHPQYVVRPFIDKIKHFQETANGLIKIMT
FAPEVEGAKEALETYKDDIIFSIGHTVATYEEAVEAVERGAKHVTHLYNAATPFQHREPG
VFGAAWLNDALHTEMIVDGTHSHPASVAIAYRMKGNERFYLITDAMRAKGMPEGEYDLGG
QKVTVQSQQARLANGALAGSILKMNHGLRNLISFTGDTLDHLWRVTSLNQAIALGIDDRK
GSIKVNKDADLVILDDDMNVKSTIKQGKVHTFS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaattaattatatataacggcaaagtttatactgaagatggcaaaatcgataat
ggttacattcatgtgaaagatggacagattgttgcaattggagaagtggatgataaagca
gcaattgataatgatacgacaaataaaattcaagtgattgatgctaaaggtcatcatgta
ttaccaggttttattgatatacatattcatggtggttatggtcaagatgcaatggatggg
tcatacgatggcttaaaatatctatccgaaaatttgttgtctgaagggacgacatcatac
ttggccactacaatgacgcaatcgactgataaaatagataatgcacttacaaatattgct
aaatatgaagcggagcaagatgttcacaatgcagcggaaattgtaggtatacatttagaa
ggaccatttatatctgaaaataaagttggtgctcaacatccgcaatacgttgtacgccca
tttatcgataaaattaaacattttcaagagactgctaacggattaataaagattatgacg
tttgcacctgaagttgaaggtgcaaaagaagcgcttgaaacgtataaagatgacattatt
ttttcaattggtcatacagtagcaacatacgaagaagcagttgaagctgttgagcgagga
gctaaacatgtcacgcatttatataatgcagcgacgccattccaacatagagaaccaggt
gtttttggagcagcatggttgaatgatgctctacataccgaaatgattgttgatggcact
cattctcatccggcatcggttgcaattgcttaccgtatgaaaggtaatgaacgtttttat
ttaattaccgatgcaatgcgtgcaaaaggtatgcctgaaggagaatatgatttgggtgga
caaaaagtaactgttcaatcgcaacaagcacgtcttgcaaatggtgcgcttgctggtagt
attttaaaaatgaatcatgggttacgtaacttaatatcatttacaggtgatacattagat
catttatggcgagtaacaagtttaaatcaagccattgcattaggtatcgatgatagaaaa
ggtagtattaaagtaaataaggatgcagatcttgttattctagatgatgatatgaatgta
aaatctacaataaaacaaggcaaggttcacacatttagctaa

DBGET integrated database retrieval system