KEGG   Staphylococcus aureus M1 (MRSA): BN843_8370Help
Entry
BN843_8370        CDS       T02618                                 

Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit 1
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
saum  Staphylococcus aureus M1 (MRSA)
Pathway
saum00473  D-Alanine metabolism
saum01100  Metabolic pathways
saum01503  Cationic antimicrobial peptide (CAMP) resistance
saum02020  Two-component system
saum05150  Staphylococcus aureus infection
Module
saum_M00725  Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon
Brite
KEGG Orthology (KO) [BR:saum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN843_8370
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN843_8370
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    BN843_8370
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN843_8370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:saum01504]
    BN843_8370
Enzymes [BR:saum01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     BN843_8370
Antimicrobial resistance genes [BR:saum01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    BN843_8370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C NIR_SIR
Motif
Other DBs
NCBI-ProteinID: CCW21170
Position
896788..898245
Genome map
AA seq 485 aa AA seqDB search
MTDIINKLQAFADANPQSIAVRHTTDELTYQQLMDESSKLAHRLQGSKKPMILFGHMSPY
MIVGMIGAIKAGCGYVPVDTSIPEDRIKMIINKVQPEFVFNTTDESFESLEGEVFTIEDI
KTSQDPVIFDSQIKDNDTVYTIFTSGSTGEPKGVQIEYASLVQFTEWMLELNKSGNEQQW
LNQAPFSFDLSVMAIYPCLASGGTLNLVDKNMINKPKLLNEMLTATPINIWVSTPSFMEM
CLLLPTLNEEQYGSLNEFFFCGEILPHRAAKALVNRFPSATIYNTYGPTEATVAVTSIQI
TQEILDQYPTLPVGVERPGARLSTTDEGELVIEGQSVSLGYLKNDQKTAEVFNFDDGIRT
YHTGDKAKFENGQWFIQGRIDFQIKLNGYRMELEEIETQLRQSEFVKEAIVVPVYKNDKV
IHLIGAIVPTTEVTDNAEMTKNIKNDLKSRLPEYMIPRKFEWMEQLPLTSNGKIDRKKIA
EVING
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacagatattattaacaagctgcaagcgtttgcggatgcaaatccacaaagcattgct
gttagacacacaactgatgaattaacttatcaacagttaatggatgagtctagtaaatta
gcacatcgattacaaggtagtaagaaaccgatgattttattcggtcacatgtcaccatat
atgattgttgggatgattggtgccattaaagcaggatgtggatatgtacctgtagacact
tcaattcctgaagaccgtattaaaatgattattaacaaggttcaaccagagtttgtattt
aatacgactgatgaatcatttgaaagtttagaaggcgaagtatttacaatagaagatatt
aaaacatctcaagacccagtaatttttgatagtcagattaaagataacgacacagtatac
acaatctttacatctggttctactggggaacctaaaggtgttcaaattgaatatgcaagt
ttagttcaatttactgagtggatgttagaacttaataaatcaggaaatgaacaacaatgg
cttaaccaagcgccattttcatttgatttatctgtaatggctatttatccatgtttagca
tcaggcggtacattaaatcttgtagataaaaacatgattaataaacctaaattattaaat
gaaatgctaacagcaacaccgattaacatttgggtatcaacaccatcatttatggaaatg
tgtttattattaccaacgcttaatgaagaacaatatggtagtcttaacgaattcttcttc
tgtggtgaaattctacctcacagagcagcaaaagcgttagtaaaccgtttcccaagtgcg
acgatttacaacacatatggtccaactgaagctacggtagcagttacaagtattcaaatt
acacaagaaatcttagatcaatatccgacattacctgttggcgttgaaagaccaggcgca
agattatctactacagatgaaggtgaacttgttatcgaaggtcaaagtgtaagtttagga
tacttaaaaaatgaccaaaaaacagctgaagtatttaatttcgatgacggtattcgtaca
tatcacactggtgataaagcgaagtttgaaaatggtcaatggttcattcaaggtcgtatt
gatttccaaatcaaattgaatggctacagaatggaattagaagaaattgaaacacaatta
cgccagtctgagttcgtaaaagaagcgattgttgtacctgtatataaaaatgataaagtt
attcatttaattggtgcaattgtgccaacgactgaagttacggacaatgcagaaatgact
aaaaatattaaaaatgacttgaaatcacgcttaccagagtatatgattcctagaaagttt
gaatggatggaacaattgccattgacttcaaatggtaaaattgacagaaagaaaattgca
gaggtaattaacggatga

DBGET integrated database retrieval system