KEGG   Staphylococcus aureus subsp. aureus CN1 (CA-MRSA): SAKOR_00565Help
Entry
SAKOR_00565       CDS       T02826                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saun  Staphylococcus aureus subsp. aureus CN1 (CA-MRSA)
Pathway
saun00071  Fatty acid degradation
saun00072  Synthesis and degradation of ketone bodies
saun00280  Valine, leucine and isoleucine degradation
saun00310  Lysine degradation
saun00362  Benzoate degradation
saun00380  Tryptophan metabolism
saun00620  Pyruvate metabolism
saun00630  Glyoxylate and dicarboxylate metabolism
saun00640  Propanoate metabolism
saun00650  Butanoate metabolism
saun00900  Terpenoid backbone biosynthesis
saun01100  Metabolic pathways
saun01110  Biosynthesis of secondary metabolites
saun01120  Microbial metabolism in diverse environments
saun01130  Biosynthesis of antibiotics
saun01200  Carbon metabolism
saun01212  Fatty acid metabolism
saun02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAKOR_00565
   00630 Glyoxylate and dicarboxylate metabolism
    SAKOR_00565
   00640 Propanoate metabolism
    SAKOR_00565
   00650 Butanoate metabolism
    SAKOR_00565
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAKOR_00565
   00072 Synthesis and degradation of ketone bodies
    SAKOR_00565
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAKOR_00565
   00310 Lysine degradation
    SAKOR_00565
   00380 Tryptophan metabolism
    SAKOR_00565
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAKOR_00565
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAKOR_00565
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAKOR_00565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saun04147]
    SAKOR_00565
Enzymes [BR:saun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAKOR_00565
Exosome [BR:saun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAKOR_00565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGU60705
UniProt: T1Y748
Position
602588..603739
Genome map
AA seq 383 aa AA seqDB search
MNYNMNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNV
VGNGGNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVEST
SRAPWKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYR
SHQLTAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANS
CMKNDGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLT
IENIEVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFD
KETMIASMGIGGGLGNAALFTRF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgaattataatatgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaa
tatggtggcactttaaaacatttagagccagaacaattgcttaaacctttattccaacat
tttaaagagaagtatccagaggtaatatctaaaatagatgatgtagttttaggtaatgtt
gttgggaatggtggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattca
atacctggcgtcacaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgca
tgtcgcatgatccaagccggagctggcaaggtatatattgcaggtggtgttgaaagtaca
agtcgagcaccttggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgag
ttttatgagcgtgcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgct
gaaaatgtggccaagatgtatgatgtttcaagagaattacaagatgaatttgcttatcga
agtcatcaattgacagcggaaaatgtaaagaatggaaatatttctcaggaaatattacct
ataaccgttaaaggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaa
gataactttggccgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagt
tgtatgaaaaatgatggtgcagttttattgcttattatggaaaaagatatggcatacgaa
ttaggtttcgagcatggtttattatttaaagatggtgttacggtaggtgttgattctaat
tttcctggcattggtccagtaccagccatttccaacttactaaaaagaaatcaattaacg
atagaaaatattgaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgc
caacaagctttaaatatttcaaatacgcaattaaatatatggggtggtgcattagcatca
ggtcatccatacggtgcaagcggtgcccaattagtgactcgattattttatatgtttgac
aaagagactatgattgcatctatggggatagggggaggtctaggaaatgcagcattattc
actcgattctaa

DBGET integrated database retrieval system