KEGG   Staphylococcus aureus subsp. aureus CN1 (CA-MRSA): SAKOR_01072Help
Entry
SAKOR_01072       CDS       T02826                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
saun  Staphylococcus aureus subsp. aureus CN1 (CA-MRSA)
Pathway
saun00471  D-Glutamine and D-glutamate metabolism
saun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saun00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SAKOR_01072
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saun01011]
    SAKOR_01072
Enzymes [BR:saun01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SAKOR_01072
Peptidoglycan biosynthesis and degradation proteins [BR:saun01011]
 Precursor biosynthesis
  Racemase
   SAKOR_01072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AGU61212
UniProt: T1Y813
Structure
PDB: 

Position
1100191..1100991
Genome map
AA seq 266 aa AA seqDB search
MNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIGRCPYGPRPGEQVKQYTVEIARKL
MEFDIKMLVIACNTATAVALEYLQKTLSIPVIGVIEPGARTAIMTTRNQNVLVLGTEGTI
KSEAYRTHIKRINPHVEVHGVACPGFVPLVEQMRYSDPTITSIVIHQTLKRWRNSESDTV
ILGCTHYPLLYKPIYDYFGGKKTVISSGLETAREVSALLTFSNEHASYTEHPDHRFFATG
DPTHITNIIKEWLNLSVNVERISVND
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccaataggtgtaatagactctggtgtcggaggtttgacagtagctaaagaa
attatgcgtcagttgccaaatgagacgatttattacttaggtgatattggacgatgtcca
tatgggccaagaccaggagaacaagtaaaacaatatacagttgaaatcgctcgtaaatta
atggaatttgatataaaaatgctcgtgattgcttgtaatacagcaactgctgtagcttta
gaatatttacaaaagaccttatcaatcccagtgattggcgtaattgaaccaggtgctaga
acagcaataatgactactagaaatcaaaatgtattagtactaggaacggaaggcacaatt
aaatctgaagcatatcgtacgcatattaaacgtatcaatccacatgtagaggtacatggc
gttgcctgtccaggttttgtgccacttgtagaacaaatgagatatagtgatccaacaatt
acaagcattgtcattcatcaaacactgaaacgttggcgtaatagtgagtctgatactgtc
attttaggatgtacccactatccattgctctataaacctatctatgattattttggtggt
aaaaagacagtgatttcgtctggattagaaacggctcgtgaagttagtgcattgctaaca
tttagtaatgaacatgcaagttatactgaacatccagatcatcgattttttgcaacaggt
gatcctactcacattactaacattatcaaagagtggttaaatttatctgtcaatgtggaa
cgtatatcagtgaatgactag

DBGET integrated database retrieval system