KEGG   Staphylococcus aureus subsp. aureus CN1 (CA-MRSA): SAKOR_01251Help
Entry
SAKOR_01251       CDS       T02826                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
saun  Staphylococcus aureus subsp. aureus CN1 (CA-MRSA)
Pathway
saun00260  Glycine, serine and threonine metabolism
saun01100  Metabolic pathways
saun01110  Biosynthesis of secondary metabolites
saun01120  Microbial metabolism in diverse environments
saun01130  Biosynthesis of antibiotics
saun01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAKOR_01251
Enzymes [BR:saun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SAKOR_01251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGU61391
UniProt: T1Y812
Position
complement(1285799..1286878)
Genome map
AA seq 359 aa AA seqDB search
MKLVYLIKMLILVLGGNVVISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIE
KIKDTIDCPNATIRFLVGGTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKV
ITIPSKEGKVSASDVETYMETFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKV
CKQYQLPLFMDGARLGYGLMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNE
PKQFTTRIKHHGALLAKGRLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFINKGYRLY
FDSPTNQQFFILSNEKIAELEQKVKFAVWEKYDDQHRVVRFATSWATTEENLNKLLELI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattagtttatcttattaaaatgctgatattagttttagggggaaatgtagtgatc
tcatttgaaaatgattatttagaaggtgctcatgaaaaagtattaaaacgattagtagat
acaaatcttgtacaagcttcgggatatggctttgatcaattcacagctcaggcaattgaa
aagattaaagatacaattgattgtccaaatgctactatccgttttttagtaggtggaacg
caaaccaatcaggttgttattaattcaatgttagaaagttacgaaggggttatttcagca
gacactggtcatgttgctgtgcatgagggcggtgcaattgaatatagtggacataaagta
attactataccctctaaggaaggaaaagttagtgcttcagatgttgaaacttacatggag
acatttaaaagtgattttaaaaaggaccatatggtattcccaggaatggtatatatttct
catcctacagaatatggcacattatactctaaatcagaattggaagagttatgcaaagta
tgtaagcaatatcagcttccattatttatggatggtgcacgattagggtatggattgatg
agtgatcaatcagatatgactattaaagacatcgctaaatattgtgatgtattttatata
ggtggtacgaagataggtgcattatgcggagaagcaattgtttttacgaagaataatgaa
ccgaaacaatttaccactcgaatcaaacatcacggtgcacttttagcaaaaggacggtta
acaggcatacaatttttagaattatttacggataatttatattttaatataagcagacat
gctatcgaaatggcaaataagatgaaagacgggtttataaataaaggctatcgtctttac
tttgattctccaaccaatcaacaattttttattttaagtaacgagaaaatagcagagtta
gaacaaaaagttaaatttgctgtttgggaaaaatacgatgatcaacatcgtgttgttaga
ttcgcaaccagctgggcgacaaccgaagaaaatttaaataaactattagaattaatctaa

DBGET integrated database retrieval system