KEGG   Staphylococcus aureus subsp. aureus CN1 (CA-MRSA): SAKOR_01806Help
Entry
SAKOR_01806       CDS       T02826                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
saun  Staphylococcus aureus subsp. aureus CN1 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:saun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:saun03009]
    SAKOR_01806
Enzymes [BR:saun01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SAKOR_01806
Ribosome biogenesis [BR:saun03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SAKOR_01806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AGU61946
UniProt: T1Y9K2
Position
1864920..1865741
Genome map
AA seq 273 aa AA seqDB search
MKFKIPENFNDLSLRDIFQQLKVPKKDLHHLNMSKDITINDKPARLMDKVHTGDDVFVPT
IDEKSNYVPSYRYAQIKYEDDDMAIVMKPKGVKTHPNDLKESNTLMNHVIYTIDSDYVEP
IHRLDQETVGLLIVAKNPLMKKILDRMLEDNDITRIYKANVKALLPLKPQTIDMPIGKDK
FHSNKRRVSPTGQRAITHILTSKMIKEAVCQLEIKLDTGRTHQIRVHLAEIGHPVIGDPL
YGDSTLRQLELESYKIEFVHPLTKEVISVSLDD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaaaataccagaaaactttaatgacttaagtttacgagatattttccaacaa
cttaaggtacctaaaaaagatttacatcatttaaatatgtctaaagatattactattaat
gataaacctgcgcgattaatggataaagtgcatactggcgacgatgtatttgttccaacc
atcgatgaaaaaagtaattatgttccaagttatcgttatgcacaaattaaatacgaagac
gatgatatggcaatcgtaatgaaacctaaaggtgttaagactcaccctaatgatttaaaa
gaaagcaatactttaatgaatcatgtgatttacactattgatagtgactatgtcgaacca
attcatcgactggaccaggaaacagtaggattattaattgttgctaaaaatcctttaatg
aaaaaaattcttgatcgcatgttagaagacaatgatattacgcggatatacaaagcaaat
gttaaggcacttttacctttaaaaccacaaacgattgatatgccaattggtaaagataaa
ttccattcgaataaacgacgtgtgtctcctactggacagcgtgcaattacacacatttta
acttcaaaaatgataaaagaagctgtgtgccaacttgaaatcaagttggatactggacgt
actcatcaaattcgtgtgcatttagctgaaattggtcaccctgttattggtgatccttta
tatggtgattcaacgttaagacaattagaacttgaaagttacaaaatagagtttgtgcat
cccttgactaaggaagtcatttccgtttctttggatgactaa

DBGET integrated database retrieval system