KEGG   Streptomyces autolyticus: BV401_02045Help
Entry
BV401_02045       CDS       T04980                                 

Definition
(GenBank) hypothetical protein
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00860  Porphyrin and chlorophyll metabolism
sauo01100  Metabolic pathways
sauo01110  Biosynthesis of secondary metabolites
sauo01120  Microbial metabolism in diverse environments
Module
sauo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BV401_02045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sauo01007]
    BV401_02045
Enzymes [BR:sauo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BV401_02045
Amino acid related enzymes [BR:sauo01007]
 Aminotransferase (transaminase)
  Class III
   BV401_02045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AQA15911
UniProt: A0A1P8Y604
Position
523186..524466
Genome map
AA seq 426 aa AA seqDB search
MRRAHQVIPKGVNSSRRAVLRPTPLAFTSALGSRIIDVDGNEYVDYVAGYGPMLLGHQPP
RVIEAVRTQLAAGVLYGGQHQAEAELAERIVRMVPGAEMVLLNVTGSEAVQAALRMARAA
TGRRKTVKFEGHYHGWIDPVTANGPGSPAGTGPAPRPAIAADHHLVGPEILICPWNDPEA
LADLLGRHGADVAAVIMEPVAVNGGNLWADEGYLATARRLCDQHGCLLVFDEVVTGFRLA
PGGAQQRTGVTPDLTVLAKALGAGFPISAVAGRAEVMRIAEEIGHAGTYNGNATSVVAAN
AALDVLESDQDSLYPRLERLTNELADGIERLAARHGAPLQALRAGALIRLHWGAPTPART
YADTLAGRSEPLRHLSEHLIRSGVHARDTGLWYVSAAHTDDDVDRTLAAVDQALAAVSRQ
PVGNTG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgagcccatcaggtcatccccaagggagtgaattcctcccgccgggctgtgctg
cgacccaccccgctggccttcacctccgcactgggcagccggatcatcgacgtcgacggc
aacgagtacgtggactatgtcgccgggtacggcccgatgctgctcggacaccagccgcca
cgggtgatcgaggccgtgcgcacgcagctcgccgcgggcgtcctgtacggcggtcagcac
caggcggaggcggagctggccgagcgcatcgtccggatggtgcccggcgcggagatggtc
ctgctcaatgtgacgggcagcgaagccgtccaggcggcgctgcggatggcccgcgccgcg
acaggacgacgcaagaccgtcaagttcgagggccactaccacggctggatcgaccccgtc
accgccaacgggccgggcagccccgccggaaccggcccggcaccgcgcccggcgatcgcc
gccgatcaccatctcgtcgggcccgagattctgatctgcccctggaacgacccggaggcc
cttgccgacctgctggggcggcacggtgcggacgtcgccgcggtcatcatggagcccgtc
gcggtcaacggcggcaacctctgggccgacgaggggtatctggccacggcccgccgcctg
tgcgaccagcacggctgcctactcgtcttcgacgaggtcgtcaccggcttccggctggcc
cccggcggcgcccagcagcgcaccggcgtgacccccgacctcaccgtcctcgccaaggcc
ctcggggcagggttcccgatcagcgcggtggcgggacgtgccgaggtcatgcgcatcgcc
gaggagatcgggcacgccggaacctacaacggcaacgcgacatcagtggtcgcggccaat
gcggctctcgatgtcctggagagcgaccaggactccctctaccctcgcctcgaacgcctg
accaacgagctcgccgacggcatcgagcggctcgccgcccggcacggagcgccgttgcag
gccctgcgggccggcgccctgatccgtttgcactggggcgctcccacacctgcgcgcacc
tacgcggacacgctcgccggtcgtagcgaaccgctccgccacctctccgaacacctcatc
cgcagcggagtccacgcccgcgacaccggcctgtggtacgtctccgcggcccacaccgac
gacgatgtggaccggaccctggccgccgtcgaccaagcgctggccgcggtttcccgtcag
ccggtcggcaacaccggctag

DBGET integrated database retrieval system