KEGG   Streptomyces autolyticus: BV401_05035Help
Entry
BV401_05035       CDS       T04980                                 

Definition
(GenBank) alkene reductase
  KO
K10680  N-ethylmaleimide reductase [EC:1.-.-.-]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00633  Nitrotoluene degradation
sauo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BV401_05035
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     BV401_05035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN
Motif
Other DBs
NCBI-ProteinID: AQA09955
UniProt: A0A1P8XPF1
Position
complement(1201338..1202465)
Genome map
AA seq 375 aa AA seqDB search
MSTIASTALDRPLLRPADLGDLRLPNRVVMAPMTRARATGEGLVPNGMHTAYYGQRAGAG
LIITEGTWVSERAIGFPHVPGVYSEEQIRGWRRVTDVVHALGGRIVLQLWHTGAASHPDH
LGGARPAGPSAVDPRERSYTLGGPKATVTPREMTLAEIRDTVAEYGAASANARRAGFDGV
EIHALGSFLIPQFLNPRLNRRRDAYGRDAAGRRRLLMEIVDAAAAAWDGRRVGVRLSPHW
TAERFTADERTLADYDALVAELCDHPVAYLHLRGPAPAAPGAAPGHDAFARYRPLFDGPL
IANHGFDRESGNAVIEAGLADAVSYATHFVANPDLVARFALDRELAAGDPGTYYTGGAGG
YVDYPASGWEDGIRR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatcgcttcgaccgccctggaccggccgctgctgcgccccgcggacctgggg
gacctccgactgcccaaccgggtggtgatggcccccatgacccgggcccgcgccacgggc
gaggggctggtcccgaacggtatgcacacggcctactacggtcagcgggccggggccggg
ctgatcatcaccgaggggacgtgggtgagcgagcgggccatcggcttcccccatgtcccc
ggtgtctacagcgaggagcagatcaggggatggcgccgggtcaccgacgtggtccacgcc
ctcggcggccggatcgtgctccagctgtggcacaccggcgccgcctcgcaccccgaccac
ctcgggggcgctcggccggccggcccgtcggcggtcgatccccgggagcggtcctacacc
ctgggcgggcccaaggccacggtcaccccgcgggagatgacgctcgcggagatccgggac
acggtcgcggagtacggggcggcctcggccaacgcccgccgcgccggtttcgacggggtg
gagatccacgccctgggctcgttcctgatcccgcagttcctcaatccgcggctgaaccgc
cgccgcgacgcctacggtcgcgacgcggccgggcggcggcgcctgctgatggagatcgtc
gacgcggcggcggcggcctgggacggccgccgggtgggtgtccgtctgtcgccgcactgg
accgccgagcggttcaccgccgatgagcggacgctcgccgactacgacgcgctcgtggcg
gagctgtgcgaccaccccgtggcctatctgcatctacggggaccggcccccgccgcgccc
ggcgccgcccccggccacgacgccttcgcccgctaccggccgctcttcgacggaccgctg
atcgccaaccacggcttcgaccgggagagcgggaacgccgtgatcgaggcggggctcgcg
gacgccgtctcctatgccacgcacttcgtggccaaccccgacctggtggccaggttcgcc
ctggaccgtgagctggcggcgggcgatccgggcacgtactacaccggcggggcgggcggc
tatgtcgactatccggccagcggctgggaggacggcatcaggcgttga

KEGG   Streptomyces autolyticus: BV401_08530Help
Entry
BV401_08530       CDS       T04980                                 

Definition
(GenBank) alkene reductase
  KO
K10680  N-ethylmaleimide reductase [EC:1.-.-.-]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00633  Nitrotoluene degradation
sauo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BV401_08530
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     BV401_08530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN DUF346
Motif
Other DBs
NCBI-ProteinID: AQA10526
UniProt: A0A1P8XQP1
Position
complement(2239532..2240596)
Genome map
AA seq 354 aa AA seqDB search
MTSPFDPIDLAGLRLRNRLVMPAMGRARAFGPGNTATDSMATYYAQRATAGLIITEGSQP
SVVGQGFPNTPGLHSAEQIAAWRRVTDAVHAEGGTVFAQISHVGRVGDPALLPDGLIQVA
PSAVAAPGRLFTLDGMKDFGTPHELTSQEVRETIADFGRAAHNAIEAGFDGVELHAAYGY
LIHQFLAPSANLRTDEWGGSVEGRVRFAAEVVAAVSAAIGARRMGIRISPGIRYNGIEEP
DLEPTYVQLVRRLNETGPAYLHLVEDSRELTGILRKEFSGTLILNPATDGFTGAEDLALI
EDGTADMLSFGALFLANPDLPARLRAGGPYNTPDETTYYGGTDRGYIDYPSLNA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcacccttcgatccgatcgacctggccgggctgcggctgcgcaaccggctggtg
atgcccgccatggggcgcgcccgcgccttcgggcccggcaatacggccaccgactccatg
gcgacgtactacgcgcagcgggccacggccggcctgatcatcaccgaggggtcgcagccg
tcagtggtcggccagggcttccccaacaccccggggctgcacagcgccgagcagatcgcc
gcctggcgccgtgtcaccgacgcggtgcacgccgagggcggcacggtgttcgcccagatc
tcgcacgtcggccgggtcggcgaccccgcgctgctgcccgacgggctgatccaggtcgcc
ccctcggccgtcgccgcgcccgggcggctgttcaccctcgacgggatgaaggacttcggc
accccgcatgagctgacctcccaggaggtgcgggagacgatcgcggacttcggccgtgcc
gcgcacaacgccatcgaggcggggttcgacggggtcgaactgcacgccgcctacggctac
ttgatccaccagttcctggcgcccagcgccaatctgcgcaccgatgagtggggtggctcc
gtggaaggccgggtccgattcgcggccgaggtggtcgcggccgtctcggcggccatcggc
gcccggcgcatggggatccgcatctcgcccgggatccgctacaacgggatcgaggagccc
gacctcgagcccacctacgtccagctcgtccgacggctgaacgagaccggccccgcctat
ctccacctcgtcgaggactcccgcgagctgaccggcatcctccgcaaggagttctccgga
accctcatcctcaaccccgcgacagacggtttcaccggcgcggaggacctggcgctcatc
gaggacggcacggccgacatgctgtccttcggcgcgctgttcctcgccaaccccgatctg
ccggcccggctgcgggcgggcgggccgtacaacacacccgatgagacgacctactacggc
ggaaccgacagggggtacatcgactacccctccctgaacgcctga

KEGG   Streptomyces autolyticus: BV401_12300Help
Entry
BV401_12300       CDS       T04980                                 

Definition
(GenBank) alkene reductase
  KO
K10680  N-ethylmaleimide reductase [EC:1.-.-.-]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00633  Nitrotoluene degradation
sauo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BV401_12300
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     BV401_12300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN DUF346
Motif
Other DBs
NCBI-ProteinID: AQA11139
UniProt: A0A1P8XSC9
Position
complement(3155032..3156102)
Genome map
AA seq 356 aa AA seqDB search
MATAFDPYDLSGTRLTNRIAMAPMTRSRAHGPGASPTDLMATYYAQRASAGLVVTEGIQP
SVVGQGYPDTPGLHSADQVAAWRKVTDAVHREGGVIFAQLMHTGRIGHPALLPDGLVPVA
PSAVAPRGQVFTHEGPKDFITPRELTEAEIVRTVEDFAAAARNAVAAGFDGVEIHGANGY
LVHQFLASNANRRTDAWGGSADGRIRFAVEVATAAAEAIGGDKVGFRLSPGNPFNDIAEE
GLQETYGALVARLAPLGLAYLHQMEAPGVRDLTVRLRKEWPGTFILNPFTGSEPTGPGEL
KLVEDGTADLIAFGALFLANPDLPARLAAGGPYNTPDPTAFYGGDHRGYTDYPTLG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcattcgacccgtacgacctgagcggcacccgcttgaccaaccgcatcgcg
atggccccgatgacccgcagccgcgcccacggcccgggagcgagcccgacggatctgatg
gcgacctactacgcgcagcgggcgagcgccgggctcgtcgtcaccgagggcatccagccc
tcggtggtcgggcagggctaccccgacacccccggtctgcactcggccgaccaggtcgcg
gcctggcggaaggtgaccgacgccgtgcaccgcgagggcggggtgatcttcgcgcagctg
atgcacaccggccgcatcggccaccccgccctgctgccggacggcctggtgccggtcgcc
ccgtccgcggtggcgccgcgggggcaggtgttcacccatgagggccccaaggacttcatc
acccccagggaactgaccgaggccgagatcgtccgtaccgtcgaggacttcgcggccgcg
gcgcgcaacgcggtcgccgccgggttcgacggggtggagatccacggggcgaacggctat
ctggtccaccagttcctcgcctccaacgccaaccggcgcaccgacgcctggggcggctcg
gccgacggccggatccgcttcgcggtcgaggtggcgaccgcggcggccgaggccatcggc
ggggacaaggtgggcttccgcctctcaccgggcaaccccttcaacgacatcgccgaggag
ggacttcaggagacctacggcgccctggtggctcggctggccccgctgggcctggcctat
ctgcaccagatggaggcgccgggcgtacgcgacctgaccgtacgcctgcgcaaggagtgg
cccggcaccttcatcctcaacccgttcaccggcagcgagcccaccgggcccggtgagctg
aagctggtggaggacggcacggccgacctgatcgccttcggcgcgctgttcctggccaac
cccgaccttccggcccgcctcgccgccggcggcccgtacaacacccccgaccccaccgcc
ttttacggtggcgatcaccgcggctacaccgactacccgaccctcggctga

DBGET integrated database retrieval system