KEGG   Streptomyces autolyticus: BV401_07860Help
Entry
BV401_07860       CDS       T04980                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00260  Glycine, serine and threonine metabolism
sauo01100  Metabolic pathways
sauo01110  Biosynthesis of secondary metabolites
sauo01120  Microbial metabolism in diverse environments
sauo01130  Biosynthesis of antibiotics
sauo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BV401_07860
Enzymes [BR:sauo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BV401_07860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Glyco_hydro_20
Motif
Other DBs
NCBI-ProteinID: AQA10415
UniProt: A0A1P8XQQ9
Position
complement(2044103..2045182)
Genome map
AA seq 359 aa AA seqDB search
MADPQAVRTDARRHHDPEVRGFASDNYAGVHPEILAALALANEGHQVSYGEDDYTAHLQF
VMRSHFGPHAQAFPVFNGTGSNVVALQALTDRWGAVICAESAHINVDECGAPERVGGLKL
LTVPTEDGKLTPELIDRQAWGWDDEHRAMPQVVSIAQNTELGTVYTVDEIRAICDHAHER
GMKVHLDGARIANAAAALDVPMRAFTNAAGVDIVSFGGTKNGMLFGEAVVVLDPDAVRAM
KHLRKLSMQLASKMRFISVQLEALLARDLWLRSARHANTMARRLADGVRSVDGVKILHPV
QANAVFARLPHEVSERLQKRYRFYFWDETAGDVRWMCSFDTTEEDVDGFITALKEEMGR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacccccaagccgtgaggaccgacgcccgccgccaccacgatcccgaggtacgc
ggcttcgccagcgacaactacgccggcgtccacccggagatcctcgccgcgctcgccctc
gccaacgaaggccatcaggtctcctacggcgaggacgactacaccgcgcatctccagttc
gtcatgcgcagccacttcggcccgcacgcacaggcgttcccggtcttcaacggaaccggg
tccaacgtcgtcgcgctccaggccctcaccgaccgctggggcgcggtcatctgcgccgag
agcgcccatatcaacgtcgacgagtgcggggcgcccgagcgcgtcggcgggctgaagctg
ctcaccgtccccaccgaggacggcaagctcacccccgagctcatcgaccgccaggcgtgg
ggttgggacgatgagcaccgggcgatgccgcaggtcgtctcgatcgcccagaacaccgag
ctcggcaccgtctacacggtggacgagatccgcgccatctgtgaccacgcccatgagcgc
gggatgaaggtccacctcgacggcgcccggatagccaacgcggccgcggcgctggacgtg
ccgatgcgtgcgttcaccaacgcggcgggcgtcgacatcgtgtccttcggcggcaccaag
aacggaatgctcttcggcgaggccgtcgtcgtcctcgatccggacgcggtgcgcgccatg
aagcatctgcgcaagctgtccatgcagctggcgtccaagatgcggttcatctccgtccag
ctggaggcactgctcgcccgcgacctgtggctgcgcagcgcccgccacgccaacaccatg
gcccggcggctggccgacggcgtgcgctcggtggacggagtgaagatcctccacccggtc
caggccaacgcggtcttcgcccgcctcccgcacgaggtgagcgaacgcctccagaagcgc
taccgcttctacttctgggacgagaccgcgggcgatgtgcgctggatgtgctccttcgac
accacggaggaggacgtggacggcttcatcaccgccctcaaggaggagatgggccgctag

DBGET integrated database retrieval system