KEGG   Streptomyces autolyticus: BV401_10705Help
Entry
BV401_10705       CDS       T04980                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00625  Chloroalkane and chloroalkene degradation
sauo00680  Methane metabolism
sauo01100  Metabolic pathways
sauo01120  Microbial metabolism in diverse environments
sauo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BV401_10705
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BV401_10705
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BV401_10705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C HI0933_like GCD14
Motif
Other DBs
NCBI-ProteinID: AQA10876
UniProt: A0A1P8XRQ5
Position
complement(2783577..2784746)
Genome map
AA seq 389 aa AA seqDB search
MKAAVYEGPRNVAVEEKPDPRIEHPCDAIVKITTTNICGSDLHMYEGRTSFEKGRIFGHE
NLGQVIEVGSAVRKLKVGMYVVLPFNIACGFCKQCERGLTNYCLTMQPEPSAAGAAYGFA
DMGPYQGGQAEFLRVPYADFNALRLGEDAEERQTDYVMLADIFPTGYHATEMADVKPGDQ
TVIYGAGPVGLMAAYSAVIKGAGRVWVCDFHTDRLRKAEEIGAMPIDMREQDPGEVIKEA
TLGLGADNGCECVGYQAHDPSGHEDASRTMNSLIESVRFTGCIGVVGVFVREDPAGREAQ
PQIGDFEAKGKVPIDWGKLWFKGQQIGTGQAPVKRYNRRLRDLIAGGKAKPSWVVSHELP
LDQAPDAYDHFDRRDEGWTKVILHPDGSG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtatacgaaggaccgcggaacgtcgcggtcgaggagaagcccgacccg
aggatcgagcacccctgcgacgcgatcgtcaaaatcaccaccaccaatatctgtggctcc
gatctgcatatgtacgaagggcgtacgtcgttcgagaagggccgcatcttcgggcacgag
aacctggggcaggtcatcgaggtcggctcggcggtcagaaagctcaaggtcggcatgtat
gtggtgctgccgttcaacatcgcctgcggcttctgcaaacagtgcgagcgcggcttgacc
aactactgcctgaccatgcagccggagccctcggccgccggagccgcttacggcttcgcg
gacatggggccgtaccagggcggccaggccgagtttctgcgcgtgccgtacgcggacttc
aatgcgctgcggctgggcgaggacgccgaagagcgccagacggactacgtgatgctggcc
gacatcttccccaccggctaccacgccaccgagatggcggacgtcaagcccggggaccag
accgtcatctacggtgcgggtcccgtagggctgatggcggcctactcggcggtgatcaag
ggtgctggacgggtgtgggtgtgcgacttccacaccgatcggttgcgcaaggccgaggag
atcggcgccatgccgatcgacatgcgcgagcaggacccgggcgaggtcatcaaggaagcc
actttggggctcggcgccgacaacggctgcgagtgcgtcggctaccaggcccatgacccg
tcgggccacgaggacgcctcccgcacgatgaacagcctgatcgagagcgtccgcttcacc
gggtgcatcggcgtggtgggcgtgttcgtccgcgaggacccggccggcagggaagcccag
ccccagatcggcgacttcgaggccaagggcaaggtgcccatcgactggggcaagctgtgg
ttcaagggccagcagatcggcaccggtcaggcgccggtgaagaggtacaaccgccggctg
cgcgacctgatcgccgggggcaaggccaagcccagctgggtggtctcccatgagcttccg
ctggaccaggcccccgacgcctatgaccacttcgaccgccgggacgagggctggaccaag
gtcatcctgcacccggacggttccggctga

DBGET integrated database retrieval system