KEGG   Streptomyces autolyticus: BV401_17875Help
Entry
BV401_17875       CDS       T04980                                 

Definition
(GenBank) cellobiohydrolase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00500  Starch and sucrose metabolism
sauo01100  Metabolic pathways
sauo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BV401_17875
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BV401_17875
Enzymes [BR:sauo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     BV401_17875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: AQA12039
UniProt: A0A1P8XUX9
Position
4548768..4550135
Genome map
AA seq 455 aa AA seqDB search
MSRRIRMAGTLLAASALTMGALTGVASAQGDSGRAAAAKVDNPYSGAKVYVNPDWSAKAA
AEPGGSKISNQPTGIWLDRIAAINGTGGAMGLRAHLDQALQQSGGSPTVVQLVVYDLPGR
DCSALASNGELGPTEIDKYKTQFIDPIASILSESKYANSNLRIVTTIEIDSLPNLVTNTG
SRPTATPQCDTMKANGNYVKGVGYALNKLGAIGNVYNYVDAGHHGWIGWDDNFNPSAQVI
KEAATAEGSTVDKVAGIIVNTANYSTLKENNFTVNDSVNGTTVRQSKWVDWNKYVDELSF
AQAFRQELVNVGFPSNIGALIDTSRNGWGGSARPSGPGAKTDVDTYVNGGRYDRRIHIGN
WCNQAGAGLGERPKAAPASGIDAYVWMKPPGESDGSSSEIPNDEGKGFDRMCDPTYTGNP
RNGNNLSGALANAPVSGHWFSAQFQELLKNAYPAL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcagaatccgaatggcgggcactctgctcgccgcctccgcgctgaccatgggg
gcgctgaccggcgtggcgtccgcccagggggacagcggcagggcggccgccgcgaaggtc
gacaacccctactcgggcgccaaggtgtatgtgaaccccgactggtcggcgaaggccgcc
gccgaacccggcggcagcaagatctccaaccagccgaccggcatctggctggaccggatc
gccgcgatcaacggcaccggcggcgcgatggggctgcgcgcccacctcgaccaggcgctc
cagcagtccggtggcagcccgaccgtcgtccagttagtggtctacgacctgcccggccgt
gactgctccgcgctggcgtccaacggcgagctgggcccgaccgagatcgacaagtacaag
acgcagttcatcgacccgatcgcgtcgatcctctccgagtcgaagtacgccaactccaat
ctgcggatcgtcaccacgatcgagatcgactcgctgcccaacctggtcaccaacaccggc
agccgccccaccgcgaccccgcagtgcgacaccatgaaggccaacggcaactatgtgaag
ggcgtcggctacgccctgaacaagctgggtgccatcggcaacgtctacaactacgtggac
gccggccaccacggctggatcggctgggacgacaacttcaacccgagcgcccaggtgatc
aaggaggcggcgacagccgagggcagcacggtcgacaaggtggccggcatcatcgtcaac
acggccaactacagcacgctcaaggagaacaacttcaccgtcaacgactcggtcaacggc
accaccgtgcgccagtcgaagtgggtggactggaacaagtacgtggacgagctctccttc
gcccaggcgttccgccaggagctggtcaacgtcggcttcccgagcaacatcggcgcgctg
atcgacacctcccgcaacggctggggcggctcggcccggcccagcggccccggtgcgaag
acggacgtcgacacctacgtcaacggcgggcgctacgaccgccgcatccacatcggcaac
tggtgcaaccaggccggcgccgggctcggtgagcggcccaaggcggcacccgcctccggg
atcgacgcgtatgtgtggatgaagcctccgggcgagtccgacgggtcgagctccgagatc
ccgaacgacgagggcaagggcttcgaccggatgtgcgacccgacgtacaccggcaacccg
cgcaacggcaacaacctgtcgggcgcgctggcgaacgctccggtgtcgggccactggttc
tcggcccagttccaggagctgctgaagaacgcctacccggcgctgtaa

DBGET integrated database retrieval system