KEGG   Streptomyces autolyticus: BV401_21105Help
Entry
BV401_21105       CDS       T04980                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
sauo  Streptomyces autolyticus
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BV401_21105
Enzymes [BR:sauo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BV401_21105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Sortase
Motif
Other DBs
NCBI-ProteinID: AQA12569
UniProt: A0A1P8XWH6
Position
5316256..5317065
Genome map
AA seq 269 aa AA seqDB search
MRIAVGQFAATPDWKDNLAACQELTAQAVRGGADLLVLPEGVLARFTEDRHRIREVAQPL
DGPFVSEMLAATAGSATTVVVGIHEPSEDGRVFNTLVALRDGELVARYRKIHLYDAFGDL
ESANVRPADEPPVVIDVAGTKVGLMTCYDVRFPELARLLVDAGAEVLALPAAWVRGPAKE
RHWEVMITARALENTCWVAASGECGPRNIGNSLVVDPLGTVRSRLAAAPGLAWADAAPDT
TAAARRTLPVLANRRFAVDPTVIPLGAPQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgccgtaggacagttcgccgccacccccgactggaaggacaatctggccgcc
tgccaggagctcaccgcccaggcggtacggggcggcgcggatctgctcgtcctccccgag
ggcgtgctggcccgcttcaccgaggaccgccaccgcatccgcgaggtggcccagcccctc
gacgggcccttcgtctccgagatgctcgccgccaccgccgggtcggccaccaccgtggtg
gtcggcatccatgaaccgtccgaggacggtcgggtgttcaacaccctggtggcgctgcgc
gacggtgagctggtcgcccgctatcgcaagatccacctctatgacgccttcggcgatctg
gagtcggccaacgtccgcccggcggacgagccgcccgtcgtcatcgatgtggcgggcacc
aaggtcggcctgatgacctgctacgacgtccgcttccccgagctggcccggctgttggtg
gacgccggtgccgaggtgctcgccctgcccgcggcgtgggtgcgcggcccggccaaggaa
cggcactgggaggtcatgatcaccgcacgggccctggagaacacctgctgggtggcggcg
agcggcgaatgcggtccgcgcaacatcggcaacagcctcgtcgtcgacccgctcggcacc
gtccgctcccgcctcgccgcggcacccggcctggcctgggcggacgccgctcccgacacc
accgccgcggcccgtcgcaccctccccgtcctggccaaccgccggttcgccgtcgacccc
accgtcatccccctcggagcgccccagtga

DBGET integrated database retrieval system