KEGG   Streptomyces autolyticus: BV401_25535Help
Entry
BV401_25535       CDS       T04980                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00130  Ubiquinone and other terpenoid-quinone biosynthesis
sauo00627  Aminobenzoate degradation
sauo01100  Metabolic pathways
sauo01110  Biosynthesis of secondary metabolites
sauo01120  Microbial metabolism in diverse environments
sauo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BV401_25535
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BV401_25535
Enzymes [BR:sauo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BV401_25535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AQA13287
UniProt: A0A1P8XYK3
Position
6288803..6289477
Genome map
AA seq 224 aa AA seqDB search
MSRRRPWVVGVSGASGTPYAASVLRALLAAGEAVDLVVSRASRLTLLDETGIGFRDAHWR
EDLCRWLARGADGTPDAFEVPAEVADVAHWAAGDLAAGPSSGSYPTKGMLIVPASTACVA
GVALGLSKDLLQRAASVTLKERRKLVVAVRETPLNGQTLKALVTLDEAGAVVLPASPAFY
AGATHIQDLVDFVAGRVLDAAGVPHKLYRRWEGELGGDRDRGTA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggcgccgtccctgggtggtcggtgtgtccggcgcgtccgggacgccgtacgcc
gcctcggtgctgcgcgcgctgctggcggcgggggaggcggtcgacctggtggtcagccgg
gcgtcgcggctgacgctgctggacgagacggggatcgggttccgggacgcccactggcgc
gaggatctgtgccgctggctggcgcggggcgcggacggtacgcccgacgccttcgaggtg
ccggccgaggtcgcggacgtggcccactgggcggccggcgacctggcggccgggccgtcc
tcggggtcgtacccgaccaaggggatgctgatcgtcccggcgagcaccgcgtgtgtggcc
ggggtggcgctgggactgtcgaaggacctgctccagcgggccgcgagcgtcacgctcaag
gagcggcgcaagctcgtggtggcggtgcgcgagacgccgctgaacgggcagacgctcaag
gctctggtgacgctggacgaggcgggcgcggtggtgctgcccgcctcgccggcgttctac
gcgggggcgacgcatatccaggatctggtggacttcgtcgcggggcgggtgctggacgcg
gcaggggtgccgcacaagctgtaccgccggtgggagggggaactcggtggggaccgggac
cggggaacggcctag

DBGET integrated database retrieval system