KEGG   Streptomyces autolyticus: BV401_25885Help
Entry
BV401_25885       CDS       T04980                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00511  Other glycan degradation
sauo00600  Sphingolipid metabolism
sauo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BV401_25885
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BV401_25885
Enzymes [BR:sauo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BV401_25885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: AQA13347
UniProt: A0A1P8XYR1
Position
complement(6366835..6368346)
Genome map
AA seq 503 aa AA seqDB search
MRPVRTLTRPALRPTLVGALTAVAVAVGPWLTSPAGAQVAHTGSASAGETVNVYLTTTSG
SDGRTVVKGLERQTPITFTTGGGGNVTVDESRTYQEFSGAGASFTDTAAWLFNSSGALSQ
GTRDEVMRKLFSPTDGIGVSFLRNPMGGSDLARFGYTFDDVPAGQTDPGLTRFSIDHDLA
DVLPLTQRARQLNPALKVMASPWTAPAWMKDNDQLNQGWLEAQYYGTYANYFVKYLQEYK
NRGVPIDYVTVQNEPTCCGGYPSMQWNGSGLNYFTKSELLPKLANAGLSTKVLALDWNWD
QWSGYGAPVVDDAAIRNHPNFGGIAWHGYGGDVRQQTTVHNQYPNVDAFDTEHSGGTWIA
NQQKEDMHNLIDYTRNWGRSWIKWSLAVDQNKGPHNGGCSTCTGLVTVHNGDSQSGRVDY
TVEYYTMGHLTKFVKPGARRIDSSASSTVPNVAWKNPDGSKALIAYNDTGGQQTLKVNWG
GQSFTYQLPAGASATFTWSGNQA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgtcaggaccctgacaagacctgcccttcgccccaccctggtgggcgccctc
acagcggtcgcggtggccgtcggcccctggctgacttcgccggcgggcgcccaggtggcc
cacaccggctcggcctcggcgggcgagaccgtcaacgtctacctgaccaccacctccggc
tcggacggccgtaccgtcgtcaagggcctggagcggcagacgcccatcacgttcacaacg
ggcggcgggggcaatgtcacggtcgacgagtcccggacgtaccaggagttctcgggcgcg
ggcgcatcgttcacggacaccgcggcatggctgttcaacagcagcggcgcactgagccag
ggcacccgcgacgaggtgatgcgcaagctcttctcccccaccgacggcatcggtgtgagc
ttcctgcgaaacccgatgggcggctccgacctcgcccgtttcggctacaccttcgacgac
gtaccggccggacagaccgaccccggcctcaccagattctcgatcgaccacgacctggcc
gacgtcctgcccctgacccagcgggccaggcagctcaacccggcgctgaaggtcatggcc
tcaccgtggaccgcccccgcctggatgaaggacaacgaccagctcaaccagggctggctg
gaggcccagtactacggcacctacgcgaactacttcgtgaagtacctccaggagtacaag
aaccgcggggtgcccatcgactacgtgaccgtgcagaacgagcccacctgctgcggcggc
tatccgtcgatgcagtggaacggctccggactcaactacttcaccaagagcgagctgctg
cccaagctggcgaacgcgggcctgagcaccaaggtgctcgccctcgactggaactgggac
cagtggtcgggctacggcgcgcccgtcgtggacgacgccgccatccgcaaccaccccaac
ttcggcggcatcgcctggcacggctacggcggcgacgtccgccagcagacgaccgtccac
aaccagtaccccaacgtggacgccttcgacaccgagcactccggcggcacctggatcgcc
aaccagcagaaggaggacatgcacaacctgatcgactacacccgcaactggggcaggagc
tggatcaagtggagcctcgcggtcgatcagaacaagggcccccacaacggcggctgctcc
acctgcaccggcctggtcaccgtgcacaacggcgacagccagagcggcagggtcgactac
accgtcgagtactacacgatgggccacctcacgaagttcgtgaaaccgggcgcccgccgc
atcgactccagcgccagctcgaccgtccccaacgtggcctggaagaaccctgacggctcc
aaggcgctgatcgcctacaacgacaccggcggccagcagacgctgaaggtcaactggggc
ggccagtccttcacctaccagctccccgccggggcctccgccaccttcacctggagcggc
aaccaggcgtag

DBGET integrated database retrieval system