KEGG   Streptomyces autolyticus: BV401_32850Help
Entry
BV401_32850       CDS       T04980                                 

Definition
(GenBank) polyprenyl diphosphate synthase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
sauo  Streptomyces autolyticus
Pathway
sauo00900  Terpenoid backbone biosynthesis
sauo01100  Metabolic pathways
sauo01110  Biosynthesis of secondary metabolites
sauo01130  Biosynthesis of antibiotics
Module
sauo_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BV401_32850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sauo01006]
    BV401_32850
Enzymes [BR:sauo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BV401_32850
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BV401_32850
    2.5.1.29  geranylgeranyl diphosphate synthase
     BV401_32850
Prenyltransferases [BR:sauo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BV401_32850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AQA16638
UniProt: A0A1P8Y834
Position
7941374..7942357
Genome map
AA seq 327 aa AA seqDB search
MVQSTVSPVMRQQVSALEPTLARICSYHLGFIDEHGDPSSAEGGKLTRSALMMLAAVGVG
LPPEDVRCQAAALELLHNSTLIHDDIIDADELRRGRPAAWKVFGASLAILAGDALEALGL
QMVVDDPGPGRAEISSVFAEAIGLVLAGQARELTVRLGPDTGIAEYDRIVEEKTSALLEC
ALVTPALRAGRPEHVLAALRGAGRHLGLAFQIFNDVEDIWGDPTVTGKPVRSDILRRNPT
FPVLAALSVDSPAGERLRRLWHADGTTEAHLQEMADLVEESGGRHTAERLSRNHLDSALE
YLGQAELSPAASTELTALFDRIVNRTP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaatccacggtatcgcccgtgatgcggcagcaggtttccgcactggagccgacc
ctggcccggatctgctcctaccacctcggcttcatcgacgaacacggtgaccccagcagc
gcggagggcggcaagctgacccgttccgccctcatgatgctggcggccgttggagtcggc
ctgccgccggaggacgtgcggtgccaggcggcggcactggagttgctgcacaactcgacc
ctgatccacgacgacatcatcgacgcggacgagctgcgtcgcggccgcccggccgcatgg
aaggtgttcggcgccagtctggccatcctggccggggacgcgttggaggctctcgggctg
caaatggtcgtcgacgaccccggccccggccgtgcggaaatctccagcgtgttcgccgaa
gccatcggtctggttctcgcgggccaggctcgcgagctcaccgtccggctgggtccggac
accggcatcgcggagtacgaccgcatcgtggaggagaagacgtccgccctgctggagtgc
gcactggtgacgcccgcactgcgggcgggtaggcccgagcacgtcctggccgccctgcgc
ggcgcgggcaggcatctgggcctcgctttccagatcttcaacgacgtcgaggacatctgg
ggcgaccccacggtgaccggcaagcccgtccggagcgacatcctgcggcgcaatccgact
tttccggtgctggcggccttgtcggtcgacagcccggccggcgaacgactgcgccggctg
tggcacgcggacggcaccacggaggcgcacctccaggagatggccgacctcgtcgaggaa
tccggcggccggcacacggccgagcggctgtcccgcaaccatctggactcggctctggag
tacctcggacaggccgagctgtccccggccgcgtccaccgaactgaccgccttgttcgac
cgcatcgtcaatcgcacgccatga

DBGET integrated database retrieval system