KEGG   Streptomyces autolyticus: BV401_38250Help
Entry
BV401_38250       CDS       T04980                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
sauo  Streptomyces autolyticus
Brite
KEGG Orthology (KO) [BR:sauo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BV401_38250
Enzymes [BR:sauo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     BV401_38250
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     BV401_38250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA HMA
Motif
Other DBs
NCBI-ProteinID: AQA15385
UniProt: A0A1P8Y4L7
Position
complement(9237455..9238474)
Genome map
AA seq 339 aa AA seqDB search
MNSSTDPATLPLIAVTMGDGAGIGPEVVVPALLDPDTLRRCRPVVIGDAERLRQAARLRD
LACEIVTVATPAEAAFTPGRINVVDLGLLPADLPWGELSPVAGDAAYQYIRTAAELAMNR
EVQGICTAPLNKKALHAGGHLFPGHTELLAELTGVEEVSMMLATPTVKVIHVTTHIGLID
AVRRIEPGLVERTVRRGHEAMVRAGTPEPVIGVCGINPHAGENGLFGYGEEEEKIVPALE
VLRADGIDARGPLPADTAFFLAGRGDYDLIVAMYHDQGHGPVKVLGLEAGVNLTVGLPVI
RTSVDHGTAFDIAGTGTADAGSMIEALRQAAEMSPSPAR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaactcctccaccgatcccgccacgcttccgctcatcgcggtgaccatgggcgacggc
gccggcatcggacccgaggtggtcgtccccgcgctgctcgacccggacactctgcggcgc
tgccggccggtggtcatcggggacgcggagcgactgcggcaggccgcccggctgcgcgac
ctcgcatgcgagatcgtcaccgtggccacgcccgcggaggcggcgttcaccccgggccgg
atcaacgtcgtcgacctcgggctgctccccgccgatctgccctggggtgagctctccccc
gtggccggggacgcggcctaccagtacatacggaccgccgccgaactcgccatgaaccgt
gaggtgcagggcatctgcaccgcgccgctgaacaagaaggcgctgcacgcgggcggccat
ctcttccccggccacaccgaattgctggccgagctcaccggggtcgaggaggtgtcgatg
atgctggccacccccacggtgaaggtcatccacgtcaccacccacatcgggctcatcgac
gcggtgcggaggatcgagcccggtctggtcgaacgcaccgtgcgccgcggccacgaggcg
atggtccgcgcgggcacccccgaaccggtgatcggggtgtgcgggatcaatccgcacgcg
ggggagaacggcctgttcggctacggcgaggaggaggagaagatcgtgcccgcgctggag
gtgctgcgcgccgacggcatcgacgcccgcggcccgctccccgccgacaccgcgttcttc
ctggccgggcgcggcgactacgacctgatcgtggcgatgtaccacgaccaggggcacggc
ccggtcaaggtgctgggcctggaggccggggtcaatctgaccgtcggtctgcccgtgatc
cgcacctccgtggaccacggcaccgccttcgacatcgccggtacgggcacggccgacgcc
ggtagcatgatcgaggcgctgcggcaggcggccgagatgtcgccgtcccccgcccgctga

DBGET integrated database retrieval system