KEGG   Staphylococcus aureus Bmb9393: SABB_00626Help
Entry
SABB_00626        CDS       T02717                                 

Gene name
vraB
Definition
(GenBank) putative acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saur  Staphylococcus aureus Bmb9393
Pathway
saur00071  Fatty acid degradation
saur00072  Synthesis and degradation of ketone bodies
saur00280  Valine, leucine and isoleucine degradation
saur00310  Lysine degradation
saur00362  Benzoate degradation
saur00380  Tryptophan metabolism
saur00620  Pyruvate metabolism
saur00630  Glyoxylate and dicarboxylate metabolism
saur00640  Propanoate metabolism
saur00650  Butanoate metabolism
saur00900  Terpenoid backbone biosynthesis
saur01100  Metabolic pathways
saur01110  Biosynthesis of secondary metabolites
saur01120  Microbial metabolism in diverse environments
saur01130  Biosynthesis of antibiotics
saur01200  Carbon metabolism
saur01212  Fatty acid metabolism
saur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SABB_00626 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SABB_00626 (vraB)
   00640 Propanoate metabolism
    SABB_00626 (vraB)
   00650 Butanoate metabolism
    SABB_00626 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SABB_00626 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SABB_00626 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SABB_00626 (vraB)
   00310 Lysine degradation
    SABB_00626 (vraB)
   00380 Tryptophan metabolism
    SABB_00626 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SABB_00626 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SABB_00626 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SABB_00626 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saur04147]
    SABB_00626 (vraB)
Enzymes [BR:saur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SABB_00626 (vraB)
Exosome [BR:saur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SABB_00626 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGP27575
UniProt: A0A0Z4E7U1
Position
673914..675053
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEEFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagagttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system