KEGG   Staphylococcus aureus Bmb9393 (MRSA): SABB_00903Help
Entry
SABB_00903        CDS       T02717                                 

Gene name
dltC
Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit 2
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
saur  Staphylococcus aureus Bmb9393 (MRSA)
Pathway
saur00473  D-Alanine metabolism
saur01100  Metabolic pathways
saur01503  Cationic antimicrobial peptide (CAMP) resistance
saur02020  Two-component system
saur05150  Staphylococcus aureus infection
Module
saur_M00725  Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon
Brite
KEGG Orthology (KO) [BR:saur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SABB_00903 (dltC)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SABB_00903 (dltC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    SABB_00903 (dltC)
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SABB_00903 (dltC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:saur01504]
    SABB_00903 (dltC)
Enzymes [BR:saur01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     SABB_00903 (dltC)
Antimicrobial resistance genes [BR:saur01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SABB_00903 (dltC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: AGP27853
UniProt: W8U0E0
Position
960579..960815
Genome map
AA seq 78 aa AA seqDB search
MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFD
RDEWATPNKIVEALEELR
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagagaacaagtattaaatttattagcagaagtagcagaaaatgatattgta
aaagaaaatccagacgtagaaatttttgaagaaggtattattgattctttccaaacagtt
ggattattattagagattcaaaataaacttgatatcgaagtatctattatggactttgat
agagatgagtgggcaacaccaaataaaatcgttgaagcattagaagagttacgatga

DBGET integrated database retrieval system