KEGG   Staphylococcus aureus Bmb9393 (MRSA): SABB_01723Help
Entry
SABB_01723        CDS       T02717                                 

Gene name
sbnB
Definition
(GenBank) Siderophore biosynthesis protein SbnB
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
saur  Staphylococcus aureus Bmb9393 (MRSA)
Pathway
saur00998  Biosynthesis of secondary metabolites - other antibiotics
saur00999  Biosynthesis of secondary metabolites - unclassified
saur01100  Metabolic pathways
Module
saur_M00875  Staphyloferrin B biosynthesis, L-serine => staphyloferrin B
Brite
KEGG Orthology (KO) [BR:saur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    SABB_01723 (sbnB)
   00999 Biosynthesis of secondary metabolites - unclassified
    SABB_01723 (sbnB)
Enzymes [BR:saur01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     SABB_01723 (sbnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH GFO_IDH_MocA Sacchrp_dh_NADP Ig_3 THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AGP27117
UniProt: A0A131IYQ7
Structure
PDB: 

Position
132593..133603
Genome map
AA seq 336 aa AA seqDB search
MNREMLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADR
IIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISS
MRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIERVFVYDQFSEACAR
FVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDV
HKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDTPGREDDDE
IILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagagatgttgtatttaaatagatcagatattgaacaagcgggaggaaatcat
tcacaagtttatgttgacgcattaacagaagcattaacagcgcatgcgcacaatgatttt
gtacaaccgcttaagccgtatttaagacaggatcctgaaaatggacacatcgcagatcga
attattgcaatgccaagtcatatcggtggtgaacacgcaatttcaggtattaagtggata
ggtagtaagcacgacaatccatcgaaacgtaatatggagcgtgcaagtggtgtcattatt
ttgaatgatccagaaacgaattatccaattgcagttatggaagcaagtttgattagtagt
atgcgtactgcagcagtttcagtgattgcagctaagcatttggctaaaaaaggatttaaa
gacttaacaatcattggttgcgggctaatcggagacaagcaattacaaagtatgttagag
caattcgatcatattgaacgcgtttttgtttacgatcaattctctgaagcgtgtgcacgc
tttgttgatagatggcaacaacagcgtccggaaattaattttattgcgacagaaaatgct
aaagaagcagtatcaaatggtgaagtagtcattacatgtaccgtaacggatcaaccatat
attgaatatgattggttacaaaagggtgcatttattagcaacatttctatcatggatgtg
cataaagaagtctttattaaagctgacaaagtcgtagtagatgactggtcacaatgtaat
cgagaaaagaaaactattaaccaattggtgttagaaggtaaattcagcaaagaagcactt
catgctgaactagggcaacttgtgacaggtgacacaccaggacgtgaagacgatgatgaa
atcatattacttaatccgatgggtatggctatcgaagatatttcaagtgcttactttatt
tatcaacaggcacaacaacaaaatattgggacaacattgaacctatattaa

DBGET integrated database retrieval system