KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_0516Help
Entry
SA40_0516         CDS       T02849                                 

Definition
(GenBank) putative ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
Pathway
saus00071  Fatty acid degradation
saus00072  Synthesis and degradation of ketone bodies
saus00280  Valine, leucine and isoleucine degradation
saus00310  Lysine degradation
saus00362  Benzoate degradation
saus00380  Tryptophan metabolism
saus00620  Pyruvate metabolism
saus00630  Glyoxylate and dicarboxylate metabolism
saus00640  Propanoate metabolism
saus00650  Butanoate metabolism
saus00900  Terpenoid backbone biosynthesis
saus01100  Metabolic pathways
saus01110  Biosynthesis of secondary metabolites
saus01120  Microbial metabolism in diverse environments
saus01130  Biosynthesis of antibiotics
saus01200  Carbon metabolism
saus01212  Fatty acid metabolism
saus02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SA40_0516
   00630 Glyoxylate and dicarboxylate metabolism
    SA40_0516
   00640 Propanoate metabolism
    SA40_0516
   00650 Butanoate metabolism
    SA40_0516
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SA40_0516
   00072 Synthesis and degradation of ketone bodies
    SA40_0516
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SA40_0516
   00310 Lysine degradation
    SA40_0516
   00380 Tryptophan metabolism
    SA40_0516
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SA40_0516
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SA40_0516
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SA40_0516
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saus04147]
    SA40_0516
Enzymes [BR:saus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SA40_0516
Exosome [BR:saus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SA40_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGW35563
Position
602219..603358
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGQFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggaggcact
ttaaaacatttagagccagaacaattgctcaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatatagcaagaaaagcattgcttgaagcggggctcaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgtatgatt
caagccggagctggcaaggtatatattgcaggcggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtagcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
caatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtggttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgacgcgattattttatatgtttgacaaagagactatg
attgcatctatggggattgggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system