KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_1342Help
Entry
SA40_1342         CDS       T02849                                 

Gene name
ndk
Definition
(GenBank) putative nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
Pathway
saus00230  Purine metabolism
saus00240  Pyrimidine metabolism
saus01100  Metabolic pathways
saus01110  Biosynthesis of secondary metabolites
saus01130  Biosynthesis of antibiotics
Module
saus_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
saus_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
saus_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:saus00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SA40_1342 (ndk)
   00240 Pyrimidine metabolism
    SA40_1342 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:saus04131]
    SA40_1342 (ndk)
Enzymes [BR:saus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SA40_1342 (ndk)
Membrane trafficking [BR:saus04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SA40_1342 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AGW36386
Structure
PDB: 

Position
complement(1496370..1496819)
Genome map
AA seq 149 aa AA seqDB search
MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPIELAETHYGEHQGKPFYND
LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL
ESAEREINLWFNENEITSYASPRDAWLYE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgtacatttttaatgattaaaccagacgcagtacaaagaaatctaattggtgaa
gtaatttcaagaattgaaagaaaaggactaaaacttgtcggtggtaaattaatgcaagta
ccaatagaacttgctgaaacacattatggtgaacaccaaggtaaaccattttataatgat
ttaatttcatttattacatcagcaccagtgttcgcaatggtagttgaaggtgaagatgca
gttaatgtatcaagacatattattggcagcaccaatccttcagaagcttcaccaggatca
attagaggtgatttaggtttaactgttggtagaaatatcattcacggttcagattcatta
gagtctgctgaacgtgaaattaatttatggtttaatgaaaatgaaattactagctatgct
tcaccacgtgatgcttggttatacgaataa

DBGET integrated database retrieval system