KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_1489Help
Entry
SA40_1489         CDS       T02849                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
Pathway
saus03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:saus00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SA40_1489
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:saus03400]
    SA40_1489
Enzymes [BR:saus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SA40_1489
DNA repair and recombination proteins [BR:saus03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SA40_1489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 T2SSE AAA_12 AAA AAA_18 AAA_14 Rad17 Mg_chelatase NTPase_1 TsaE 5_3_exonuc Helicase_RecD ABC_tran AAA_29 HHH_3 UvrD_C AAA_28 RsgA_GTPase Zeta_toxin AAA_22 AAA_16 DUF815 NACHT
Motif
Other DBs
NCBI-ProteinID: AGW36533
Position
complement(1636186..1638663)
Genome map
AA seq 825 aa AA seqDB search
MSDPTLFDYSMIKGTVEAILFQNSDNFYTVLKVDTIETNEDFDTMPTVVGFLPNIVEGDV
YTFKGQVVDHPRYGKQLKAETFEKEMPQTKEAIISYLSSDLFKGVGKKTAQNIVNTLGDN
AINDILDDHSVLEKVSGLSKKKQKQIAEQISANQESERIMIRLHDLGFGPKLSMAIYQFY
LGDTLTILDRNPYQLIYDIKGIGFNKADQLARNIGIAYNDNERLKAALLYTLEEECIKQG
HTYLPINVVIDLTVDVLNYQDEEVIEPEKLDEMLQYLNEEKRLIIDNEQVAIPSLYYSEI
KSVQNLFRIKTHTNKLTEIEQSDLQMHIGEIEDANQVNYAASQKEALQTAINSKVMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYDDYVNDDYPVVLAAPTGRASKRLQESTGLEAMT
IHRLIGWNQDTKPEDILENEINARLIIIDEMSMVDTWLFHQFLSAVPLDAQLIFVGDEDQ
LPSVGPGQVFKDLIESKAIPRVNLTEVYRQQDGSSIIELAHRMKLGQKIDITQRFHDRSF
INCQANQIPTVVEKVVTSAVNKGYTMADIQVLAPMYKGNAGIKRLNQVLQDILNPKKKDT
REIEFGDVVFRKGDKVLQLVNRPNDNIFNGDIGVIVGIFGAKENALNKDVLVVDFEGNEI
TFTKQDMMELTHAYCTSIHKSQGSEFPIVIMPIVKQYFRMLQRPILYTGLTRAKTSLVLL
GDPEAFDIGLKTNGQARLTQLCTLLKNYFNSEDEEMLENTATNDTGASQTTIDDQVEVPM
SSNASEEVTSDSTKTDTNVLTEATMFKIDPMINMGEITPYDFIER
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaccctacactatttgattattcaatgatcaaaggtactgttgaagcgatattg
tttcaaaacagtgataatttttatacagtgcttaaagtagatactattgaaacaaatgaa
gactttgatacaatgccaactgttgtagggtttcttccgaatattgttgaaggcgatgtc
tacacatttaaaggtcaagttgttgatcatccacgttatggtaaacaattaaaagcagag
acttttgaaaaagaaatgccacaaacgaaagaagcaattataagttatttatcaagtgat
ttgtttaaaggtgtaggtaaaaagacagctcaaaatattgttaatacattaggtgataat
gcgataaatgatatattagatgaccattcagtgctagaaaaagtttcgggattatctaaa
aagaaacagaaacaaattgcagaacaaatttcagcaaatcaagaatctgaaagaataatg
attcgtttacatgatttagggtttggtcctaaactttcaatggcaatttatcagttttat
ctcggtgatacactgactattttagatcgaaatccctatcaattgatttatgatattaaa
ggtattggttttaataaagcagatcaacttgctagaaatattggtatcgcttataacgat
aatgaacgattaaaagctgcgttgctctatacgttagaagaagaatgtattaaacaggga
catacatatttgcctataaatgttgttatagatttaacggttgatgtattaaattatcaa
gatgaagaagtcatcgaacctgaaaaattagacgaaatgttgcaatacttaaatgaggaa
aaacgactaattattgacaatgaacaagttgcaattccaagtttgtattattctgaaatc
aaaagtgttcaaaacttattcagaataaagacgcatacaaataaacttacggaaattgaa
cagtcagatttacaaatgcatattggcgaaatagaagatgcgaatcaagtgaactatgca
gcttcacaaaaagaagctttgcaaacggctatcaattctaaggtgatgctattaaccggt
gggccgggaacaggaaagacgacagtaattaaaggcattgtagaattatatgctgagatt
catggcttatcattagattatgatgattatgtcaatgatgattatccagttgtattagca
gcgccaacaggaagagcatccaaaagactacaagagtcaactggattagaagcaatgacg
attcatcgtttaataggttggaatcaagacacaaagccagaggatatattagaaaatgaa
ataaacgcacgactcataatcattgatgagatgtctatggtagatacttggttgttccac
caatttttaagtgcagttcctttagatgcgcaattgatatttgtaggtgatgaggaccaa
ttgccttctgtaggtcctggtcaagtatttaaagatttaattgaatcgaaagctatacca
cgagttaatctgactgaagtatatcgtcaacaagatggttcaagcattatagaattagca
catcgaatgaaattgggtcagaaaattgatattacacagcgttttcatgatagaagtttt
attaactgtcaggcaaaccaaataccaacagtagttgagaaggtagttactagtgctgtt
aataaagggtatactatggctgatattcaagtgcttgcaccaatgtataaaggaaatgcc
ggtattaaacgtttaaatcaagttttacaagatattttaaaccctaaaaagaaagacaca
cgagaaattgagtttggtgatgtagtctttagaaaaggtgacaaagtattacaacttgtt
aataggccaaatgataacatatttaatggtgacataggagttattgttggtatttttggg
gcgaaagaaaatgcccttaataaagatgtacttgttgtggattttgaaggtaatgaaatt
acatttacaaaacaagatatgatggaattaacgcatgcatattgtacatcaatccataaa
tcacaaggttcagaatttcctattgttatcatgcctattgttaaacagtattttagaatg
ttacaaagaccgatattatatactggtttaaccagagcgaaaacgagtttagttttactt
ggtgatccggaagcatttgatattggattgaaaacaaatggtcaagcgcgtttaacacaa
ttatgtacattgttgaaaaattattttaattcagaagatgaagaaatgctggaaaacaca
gctactaatgatacaggagcttcacaaacgacaatagatgatcaagtagaagttccaatg
tcatcgaatgctagtgaagaagttacgtctgattcaacaaaaacagatacaaatgtatta
acggaagctacaatgtttaaaattgacccaatgattaatatgggagaaatcacgccgtat
gactttatagaacgttga

DBGET integrated database retrieval system