KEGG   Staphylococcus aureus subsp. aureus SA40 (CA-MRSA): SA40_1594Help
Entry
SA40_1594         CDS       T02849                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
saus  Staphylococcus aureus subsp. aureus SA40 (CA-MRSA)
Pathway
saus00670  One carbon pool by folate
saus01100  Metabolic pathways
saus01120  Microbial metabolism in diverse environments
saus01200  Carbon metabolism
Module
saus_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:saus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SA40_1594 (fhs)
Enzymes [BR:saus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SA40_1594 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA POTRA_TamA_1
Motif
Other DBs
NCBI-ProteinID: AGW36638
Position
complement(1759146..1760813)
Genome map
AA seq 555 aa AA seqDB search
MTHLSDLDIANQSTLQPIKDIAASVGISEDALEPYGHYKAKIDINKITPRDSKGKVVLVT
AMSPTPAGEGKSTVTVGLADAFHELKKNVMVALREPALGPTFGIKGGATGGGYAQVLPME
DINLHFNGDFHAITTANNALSAFIDNHIHQGNELGIDQRRIEWKRVLDMNDRALRHVNVG
LGGPTNGVPREDGFNITVASEIMAILCLSRSIKDLKDKISRITIGYTRDRKPVTVADLKV
QGALAMILKDAIKPNLVQSIEGTPALVHGGPFANIAHGCNSILATETARDLADIVVTEAG
FGSDLGAEKFMDIKAREAGFDPAAVVVVATIRALKMHGGVAKDNLKEENVEAVKAGIVNL
ERHVNNIKKFGVEPVVAINAFIHDTDAEVEYVKSWAKENNVRIALTEVWEKGGKGGVDLA
NEVLEVIDQPNSFKPLYELELPLEQKIEKIVTEIYGGSKVTFSSKAQKQLKQFKENGWDN
YPVCMAKTQYSFSDDQTLLGAPSGFEITIRELEAKTGAGFIVALTGAIMTMPGLPKKPAA
LNMDVTDDGHAIGLF
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
ttgactcatttatcagatttagatattgcgaatcaatcaacactacaaccaattaaggat
attgctgcatcggtaggcatttcagaggatgcattagaaccttatggtcattacaaagct
aaaatcgacattaataaaattacgccaagagatagcaaagggaaagttgttttagtaact
gcaatgagtccaacaccagcaggtgagggcaaatcaacagttactgttggtttagctgac
gcatttcatgagttgaagaagaacgttatggtagcgttacgtgaacctgccttaggacca
actttcggtattaaaggtggcgcaactggtggtggttatgcgcaagtcttacctatggaa
gatatcaacttacattttaatggggatttccatgcgattacaactgctaataatgcattg
tctgcgtttatagataatcatattcaccaaggtaatgaattaggaatcgatcaaagacgt
attgaatggaaacgtgtattagatatgaatgatcgtgcacttagacatgtaaacgttggg
ttaggtggacctacaaatggtgtaccacgtgaagatggctttaatattacagtagcgtct
gaaattatggcgattttatgtttaagtagaagtattaaagacttaaaagataaaattagt
cgtattactattggttacactagagatcgcaagccagttacagttgcagatttaaaagtg
caaggtgcacttgcaatgattttaaaagatgcaattaaaccaaacttagtacaatcaatt
gaagggacaccagcattagttcatggtggaccatttgcgaatatcgcacacggttgtaac
tcaattttagcaactgaaacagcacgtgatttagctgatatcgttgtaacggaagctgga
tttggttcagacttaggcgctgaaaaattcatggacattaaggcacgtgaagctggattc
gacccagcagcagttgtagttgtagcaacgattcgtgcattaaaaatgcatggtggtgta
gcaaaagataatttaaaagaagaaaatgtagaagcagtaaaagcaggaattgttaattta
gagcgtcatgttaataatattaaaaaattcggtgtagaaccggttgttgcaattaatgca
tttatacatgataccgatgcagaagtagaatatgtaaaatcttgggctaaagaaaataac
gtacgaattgccttaactgaagtttgggaaaaaggtggtaaaggtggcgttgacttagca
aatgaagtattagaagtcattgatcaacctaattcatttaaacctttatatgaattagaa
ttaccattagagcaaaagattgaaaagattgtgactgaaatctatggcggttcaaaagta
acgtttagcagtaaagcgcaaaaacaattaaaacaatttaaagaaaatggttgggataat
tacccagtatgcatggcgaaaacacaatattcattctcagatgatcaaacgttgttaggt
gcaccatcaggatttgaaattacaattcgtgaattagaagcgaaaacaggtgcaggattt
atcgtagcattgacaggtgcaatcatgactatgcctggtttacctaaaaaaccagcagca
ttaaacatggatgttactgatgatggtcatgcaattgggctattctaa

DBGET integrated database retrieval system