KEGG   Staphylococcus aureus subsp. aureus ST228/10388 (MRSA): SAI1T1_2007920Help
Entry
SAI1T1_2007920    CDS       T03143                                 

Gene name
pycA
Definition
(GenBank) Pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
saut  Staphylococcus aureus subsp. aureus ST228/10388 (MRSA)
Pathway
saut00020  Citrate cycle (TCA cycle)
saut00620  Pyruvate metabolism
saut01100  Metabolic pathways
saut01120  Microbial metabolism in diverse environments
saut01200  Carbon metabolism
saut01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAI1T1_2007920 (pycA)
   00620 Pyruvate metabolism
    SAI1T1_2007920 (pycA)
Enzymes [BR:saut01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     SAI1T1_2007920 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp_3 HlyD_D23 HlyD_3 RimK ATP-grasp_4 GARS_A RnfC_N GCV_H ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: CCJ10753
Structure
PDB: 

Position
1069838..1073308
Genome map
AA seq 1156 aa AA seqDB search
MRSVSLLKQIKKLLVANRGEIAIRIFRAAAELDISTVAIYSNEDKSSLHRYKADESYLVG
SDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEGIKFIGPHLEHLD
MFGDKVKARTTAIKADLPVIPGTDGPIKSYELAKEFAEEAGFPLMIKATSGGGGKGMRIV
REESELEDAFHRAKSEAEKSFGNSEVYIERYIDNPKHIEVQVIGDEHGNIVHLFERDCSV
QRRHQKVVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPR
VQVEHTITEMVTGIDIVKTQILVAAGADLFGEEINMPQQKDITTLGYAIQCRITTEDPLN
DFMPDTGTIIAYRSSGGFGVRLDAGDGFQGAEISPYYDSLLVKLSTHAISFKQAEEKMVR
SLREMRIRGVKTNIPFLINVMKNKKFTSGDYTTKFIEETPELFDIQPSLDRGTKTLEYIG
NVTINGFPNVEKRPKPDYELASIPTVSSSKIASFSGTKQLLDEVGPKGVAEWVKKQDDVL
LTDTTFRDAHQSLLATRVRTKDMINIASKTADVFKDGFSLEMWGGATFDVAYNFLKENPW
ERLERLRKAIPNVLFQMLLRASNAVGYKNYPDNVIHKFVQESAKAGIDVFRIFDSLNWVD
QMKVANEAVQEAGKISEGTICYTGDILNPERSNIYTLEYYVKLAKELEREGFHILAIKDM
AGLLKPKAAYELIGELKSAVDLPIHLHTHDTSGNGLLTYKQAIDAGVDIIDTAVASMSGL
TSQPSANSLYYALNGFPRHLRTDIEGMESLSHYWSTVRTYYSDFESDIKSPNTEIYQHEM
PGGQYSNLSQQAKSLGLGERFDEVKDMYRRVNFLFGDIVKVTPSSKVVGDMALYMVQNDL
DEQSVITDGYKLDFPESVVSFFKGEIGQPVNGFNKDLQAVILKGQEALTARPGEYLEPVD
FEKVRELLEEEQQGPVTEQDIISYVLYPKVYEQYIQTRNQYGNLSLLDTPTFFFGMRNGE
TVEIEIDKGKRLIIKLETISEPDENGNRTIYYAMNGQARRIYIKDENVHTNANVKPKADK
SNPSHIGAQMPGSVTEVKVSVGETVKANQPLLITEAMKMETTIQAPFDGVIKQVTVNNGD
TIATGDLLIEIEKATD
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
ttgaggagtgtatcgctattgaaacaaataaaaaagttacttgttgctaaccgtggagaa
attgcaattcgtatattcagagcggcggcagaattagacatcagcacagttgcaatttat
tcgaatgaagacaaaagttcattacatagatataaagcagatgaatcctatttagttgga
agtgatttaggtcctgctgaaagttatttaaatattgagcgtatcattgatgtagcaaaa
caagcgaatgtggatgcgattcatcctggctatggatttttaagtgaaaatgaacaattt
gcgcgtcgttgtgcagaagaaggaattaaatttattggtcctcatttagaacatttagat
atgtttggagataaagttaaagctcgtacaacggctatcaaggcagatttaccagttatt
cctggtacagacggtccaattaaatcatatgaattagcaaaagaatttgcagaagaagct
ggtttcccgctaatgattaaagccacaagtggtggcggcggtaaaggtatgagaatcgtt
cgtgaagaaagtgaattagaagatgctttccatagagcaaaatcagaagctgaaaaatca
tttggtaatagtgaagtttacatagaaagatacattgataatccaaagcatattgaagta
caagtcataggtgacgaacatggaaatatcgtacacttatttgaacgtgattgttcagta
caacgtcgtcatcaaaaagttgtagaagttgcaccatcagttggattatcaccaacatta
cgtcaacgtatttgtgatgctgcaattcaattgatggaaaatattaaatatgtcaatgca
ggtactgttgaatttctagtatctggtgacgaattcttctttatagaagttaaccctcgt
gtacaagtagagcatacaattacagagatggtaacaggaattgatattgttaagacacaa
attttagttgcagcaggtgccgatttatttggtgaagagattaatatgccgcaacaaaaa
gatattacaacattaggctatgccatccaatgtcgtattacaacagaagatccgttaaat
gatttcatgccggatactggaacaatcattgcttatcgttcaagcggtggctttggtgta
cgtcttgatgctggagatggtttccaaggtgctgagatatcaccttattatgattcatta
ctcgtaaaattatctacacatgcgatatcatttaaacaagcagaagaaaaaatggtacgt
tcattacgagaaatgcgtattcgtggtgttaaaactaatattccattcttaattaatgta
atgaagaataaaaagttcacaagtggtgattacacaactaaatttattgaagaaacacca
gaacttttcgacattcagccgtctctagatagaggtactaaaacattagaatatataggt
aatgtaacaattaatggtttcccaaatgttgagaaacgtccgaaaccagactatgaatta
gcatcaattccaactgtatcttcaagtaaaatcgcttcatttagtggtacgaaacaattg
cttgatgaagtaggtccaaaaggtgtagctgaatgggttaaaaagcaggatgatgtctta
ctaacagatacaacctttagagatgcacaccaatcattattagctacacgagttagaact
aaggatatgattaatatcgcatccaaaacagcggacgtatttaaagatggtttctcacta
gaaatgtggggcggtgctacatttgatgtggcatataatttcttgaaggaaaacccatgg
gaacgacttgaacgtctacgtaaagctatcccaaatgtattattccaaatgttgttacgt
gcttcaaacgcagttggttataaaaactatcctgataatgttattcataaattcgtacaa
gaaagtgctaaagcaggcatagatgtctttagaattttcgattcattaaactgggtagat
caaatgaaagttgccaatgaagcagtacaagaagcgggcaaaatctctgaaggtactatt
tgttatacaggtgacattttaaatcctgagcgatcaaacatttatactttagagtattat
gtcaaactagctaaagagttagaacgtgaaggtttccatattttagcgattaaagatatg
gcaggcttattaaaacctaaagccgcttacgaattgattggtgagttaaaatcagctgta
gatttaccaattcatcttcacactcatgatacaagtggtaatggtttattaacatacaaa
caagcaatagatgctggggtcgatatcattgatactgctgttgcttcaatgagtggttta
acaagtcagccaagcgccaattcgttatattatgcattaaatggcttcccacgccacctt
agaactgatattgaaggtatggagtcacttagtcattattggtcaactgtacgtacttat
tattcagactttgaaagtgatatcaaatcaccgaatactgaaatttatcaacatgaaatg
cctggtggacagtattcgaatttaagtcaacaagctaaaagtttaggtttaggcgaaaga
tttgatgaagtcaaagatatgtatcgcagagtgaatttcttatttggtgatatcgtaaaa
gtaactccatcgtctaaagtagttggtgatatggcactttatatggtacaaaatgatctt
gatgaacaatccgtgattacagatggctataaattagatttcccagaatcagtagtgtcg
ttcttcaaaggcgaaataggacaacctgtaaatggttttaataaagatttacaagcggtt
attttaaaaggccaagaagcactaacagctcgtccaggtgaatatctagagccagttgat
tttgaaaaagtccgtgagttgcttgaagaagagcaacaaggtcctgttacggagcaagat
attattagttatgtattatatccaaaagtatatgaacaatatattcaaactagaaatcaa
tacggaaacttatcgttacttgatacgcctacattcttctttggaatgcgtaatggtgaa
acagtagaaatcgaaatcgataagggtaaacgattaattattaaactagaaacgattagt
gaaccagatgaaaatggtaatagaacgatttactatgcgatgaatggtcaagcgagacgt
atttacattaaagatgaaaatgtgcatacaaatgcgaacgttaagccaaaagcagataag
agtaatccaagtcatatcggtgctcaaatgccaggttcagtaactgaagtcaaggttagt
gttggtgaaactgtgaaagctaatcagccgttgctaattactgaagctatgaaaatggaa
acaacaattcaagcaccatttgacggtgtgattaaacaagtaactgtaaataatggtgac
acaatagcgacaggcgatttattaatcgaaattgaaaaagcaactgactaa

DBGET integrated database retrieval system