KEGG   Staphylococcus aureus subsp. aureus ST228/10388 (MRSA): SAI1T1_2010310Help
Entry
SAI1T1_2010310    CDS       T03143                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
saut  Staphylococcus aureus subsp. aureus ST228/10388 (MRSA)
Pathway
saut00670  One carbon pool by folate
saut00790  Folate biosynthesis
saut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saut00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAI1T1_2010310
   00670 One carbon pool by folate
    SAI1T1_2010310
Enzymes [BR:saut01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SAI1T1_2010310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CCJ10991
Structure
PDB: 

Position
complement(1410454..1410933)
Genome map
AA seq 159 aa AA seqDB search
MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactttatccattctagttgcacatgacttgcaacgagtaattggttttgaaaatcaa
ttaccttggcacctaccaaatgatttgaaacatgttaaaaaattatcaacaggtcatact
ttagtaatgggtcgtaagacatttgaatcgattggtaaaccactaccgaatcgtcgaaat
gttgtacttacttcagatacaagtttcaacgtagagggcgttgatgtaattcactctatt
gaagatatttaccaactaccgggccatgttttcatatttggagggcaaacattatttgaa
gaaatgattgataaagtggacgacatgtatattactgttattgaaggtaaattccgtggt
gatacgttctttccaccttatacatttgaagactgggaagttgcctcttcagttgaaggt
aaactagatgagaaaaatacaattccacatacctttctacatttaattcgtaaaaaataa

DBGET integrated database retrieval system