KEGG   Staphylococcus aureus subsp. aureus ST228/10388 (MRSA): SAI1T1_2019640Help
Entry
SAI1T1_2019640    CDS       T03143                                 

Gene name
phoB
Definition
(GenBank) Alkaline phosphatase III
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
saut  Staphylococcus aureus subsp. aureus ST228/10388 (MRSA)
Pathway
saut00730  Thiamine metabolism
saut00790  Folate biosynthesis
saut01100  Metabolic pathways
saut02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saut00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SAI1T1_2019640 (phoB)
   00790 Folate biosynthesis
    SAI1T1_2019640 (phoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAI1T1_2019640 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saut04147]
    SAI1T1_2019640 (phoB)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:saut00537]
    SAI1T1_2019640 (phoB)
Enzymes [BR:saut01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SAI1T1_2019640 (phoB)
Exosome [BR:saut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAI1T1_2019640 (phoB)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:saut00537]
 Enzymes
  SAI1T1_2019640 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme DUF1889
Motif
Other DBs
NCBI-ProteinID: CCJ11874
Position
2659732..2661156
Genome map
AA seq 474 aa AA seqDB search
MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
GPSFNTAYRYYKNDSHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
YNGAVGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKDLSKSDKDKVLGLF
ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLQKLLKKEKDEKSADVEKQTKALQH
AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagttaaaaaagccacaaaatttgcagttgctaaccttattatcgtgtcaaca
gttttcagttctgtcacacctgcaattgcgcaatccgataaaagttctaaagatgaaagt
ttcgcggttggtaatactaaaaatccaaaaaatgttatctttttagttggcgatggcatg
ggtccatcatttaacacagcttatcgttattataaaaatgattcgcatgccaaagaaatg
acccctactgcttttgattcatatttaaaaggcacaaatcgtacatattcaaatgaccca
aaacagaatattactgattctgcagctggcggaacagcctttagttctggccataagaca
tataatggtgccgtcggtgttgacagtaacaagcagaaagtaaagacagtgcttgaacgt
gcaaaagaaaaaggtaagtcgactggtcttgtttcaacagctgaattaacagatgcaaca
ccagcagcatatgctgcacacgtgacttctagagatgataaaaacgaaatcgctaaacaa
ttttataaagataaaatcaacggaaagcataaagttgatgttttattaggcggcggcgct
aaatatttcggtaaaagtaatggcaatttagataaaaaattcaaaaaagatggttacgac
cttgccacgaacagtaaggatttatcaaaatctgataaagataaagttcttggtttgttt
gcagataaaaatatgccacttgcaatagatgcttctaaagacgaaccatcattagctgat
atgcaacaaagtgcacttagtaagcttgagcgtaataaaaaaggtttctttttaatggtc
gaaggtgcttctatagataaatcagcgcattccaacgatattacaggcgttatgtctgaa
atggaaggttttgaaaaagcattcgatgacgccattcaatatgctaagaaacataaagat
acacttgtcgttgcaacagcagatcactctactggtggtctaacaattggtaaagataaa
ggatacgaatggaatcctcaaccgattaaatcgatgaaacactctggatcatatatgaca
gaaaaaatggctaaaggtgaagaccctgaaaaagttattaatgaaggttatggctttgaa
ttttcacaagatgatatgaaaaaggttaaaaaagagaataaaaagttgcaaaaattactt
aaaaaagaaaaagacgaaaaatctgcagatgtagaaaaacaaacaaaagccttacaacac
gcaattcagaagccagtaaatgataaatcttatacagggtggacttccgatggacataca
ggcgaggatgttaatacctacgcttacggacctagatcagaatcatttagtggtaatatc
gaaaatacagaaagcgcaaaaataatatttgatatattcaagtaa

DBGET integrated database retrieval system