KEGG   Staphylococcus aureus subsp. aureus SA957 (CA-MRSA): SA957_0325Help
Entry
SA957_0325        CDS       T02850                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sauu  Staphylococcus aureus subsp. aureus SA957 (CA-MRSA)
Pathway
sauu00071  Fatty acid degradation
sauu00072  Synthesis and degradation of ketone bodies
sauu00280  Valine, leucine and isoleucine degradation
sauu00310  Lysine degradation
sauu00362  Benzoate degradation
sauu00380  Tryptophan metabolism
sauu00620  Pyruvate metabolism
sauu00630  Glyoxylate and dicarboxylate metabolism
sauu00640  Propanoate metabolism
sauu00650  Butanoate metabolism
sauu00900  Terpenoid backbone biosynthesis
sauu01100  Metabolic pathways
sauu01110  Biosynthesis of secondary metabolites
sauu01120  Microbial metabolism in diverse environments
sauu01130  Biosynthesis of antibiotics
sauu01200  Carbon metabolism
sauu01212  Fatty acid metabolism
sauu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SA957_0325 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    SA957_0325 (thl)
   00640 Propanoate metabolism
    SA957_0325 (thl)
   00650 Butanoate metabolism
    SA957_0325 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SA957_0325 (thl)
   00072 Synthesis and degradation of ketone bodies
    SA957_0325 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SA957_0325 (thl)
   00310 Lysine degradation
    SA957_0325 (thl)
   00380 Tryptophan metabolism
    SA957_0325 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SA957_0325 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SA957_0325 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SA957_0325 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauu04147]
    SA957_0325 (thl)
Enzymes [BR:sauu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SA957_0325 (thl)
Exosome [BR:sauu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SA957_0325 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt BsuBI_PstI_RE
Motif
Other DBs
NCBI-ProteinID: AGW32824
Position
380294..381475
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGESIVVTMDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagaacaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaatcaatcgttgtcactatggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagtcgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system