KEGG   Staphylococcus aureus subsp. aureus ST228/18412 (MRSA): SAI7S6_1004460Help
Entry
SAI7S6_1004460    CDS       T03147                                 

Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase vraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sauv  Staphylococcus aureus subsp. aureus ST228/18412 (MRSA)
Pathway
sauv00071  Fatty acid degradation
sauv00072  Synthesis and degradation of ketone bodies
sauv00280  Valine, leucine and isoleucine degradation
sauv00310  Lysine degradation
sauv00362  Benzoate degradation
sauv00380  Tryptophan metabolism
sauv00620  Pyruvate metabolism
sauv00630  Glyoxylate and dicarboxylate metabolism
sauv00640  Propanoate metabolism
sauv00650  Butanoate metabolism
sauv00900  Terpenoid backbone biosynthesis
sauv01100  Metabolic pathways
sauv01110  Biosynthesis of secondary metabolites
sauv01120  Microbial metabolism in diverse environments
sauv01130  Biosynthesis of antibiotics
sauv01200  Carbon metabolism
sauv01212  Fatty acid metabolism
sauv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAI7S6_1004460
   00630 Glyoxylate and dicarboxylate metabolism
    SAI7S6_1004460
   00640 Propanoate metabolism
    SAI7S6_1004460
   00650 Butanoate metabolism
    SAI7S6_1004460
  Lipid metabolism
   00071 Fatty acid degradation
    SAI7S6_1004460
   00072 Synthesis and degradation of ketone bodies
    SAI7S6_1004460
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI7S6_1004460
   00310 Lysine degradation
    SAI7S6_1004460
   00380 Tryptophan metabolism
    SAI7S6_1004460
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAI7S6_1004460
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAI7S6_1004460
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAI7S6_1004460
Enzymes [BR:sauv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAI7S6_1004460
Exosome [BR:sauv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAI7S6_1004460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCJ22197
Position
606276..607415
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system