KEGG   Staphylococcus aureus subsp. aureus ST228/18412 (MRSA): SAI7S6_1007100Help
Entry
SAI7S6_1007100    CDS       T03147                                 

Definition
(GenBank) Pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sauv  Staphylococcus aureus subsp. aureus ST228/18412 (MRSA)
Brite
KEGG Orthology (KO) [BR:sauv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sauv03009]
    SAI7S6_1007100
Enzymes [BR:sauv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SAI7S6_1007100
Ribosome biogenesis [BR:sauv03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SAI7S6_1007100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CCJ22460
Position
958101..958877
Genome map
AA seq 258 aa AA seqDB search
MSAIKNNGALIVNDEPVTVRKQLMPNDILEIHLPREIPSVNLIPYARKLEVLYEDAFIII
VTKPNNQNCTPSREHPHESLIEQVLYHCQEHGENINPHIVTRLDRNTTGIVIFAKYGHIH
HLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSKDSIITREVASDGKYAKTSYEVINQND
KYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLYDGFHDKIHGQVLQCTQIYFVHPINKN
NIYITIDYKQLLKLFNQL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccattaaaaataatggcgctttaattgttaatgatgaaccagtcacagtacgt
aagcaattaatgccaaatgatatattagaaattcatttaccgcgagaaataccgagtgtt
aatttaataccttatgctcgtaagctagaagtattgtatgaagatgcttttatcatcata
gttactaaaccaaacaatcaaaattgtacgccttcgagagaacatcctcatgaaagttta
atcgaacaagtactatatcattgtcaggaacatggtgaaaatattaacccacatattgtt
acgcgtctagatcgtaatacaactggtattgtgatattcgctaaatatggacatatccat
catttattttctaaagtaaacttgaaaaaaatatatacttgccttgtatatggcaaaacc
catacatctggtattattgaagctaatattagacggtcaaaggatagtattataactaga
gaagttgcctcggatggtaaatacgctaaaacatcttatgaagtaataaatcagaatgat
aaatacagtttatgcaaagttcatttgcatacgggacgtacacatcaaattcgtgtacat
tttcaacatattgggcatccaattgtgggagattctttgtatgatggttttcatgacaaa
attcatggtcaagtactgcaatgtacgcaaatatattttgttcatccaatcaataagaac
aatatttatattacaattgattataagcaattacttaaattattcaatcaactctaa

DBGET integrated database retrieval system