KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1001780Help
Entry
SAI5S5_1001780    CDS       T03148                                 

Definition
(GenBank) Putative acyl-CoA synthetase FadE
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Pathway
sauw00061  Fatty acid biosynthesis
sauw00071  Fatty acid degradation
sauw01100  Metabolic pathways
sauw01212  Fatty acid metabolism
sauw02024  Quorum sensing
Module
sauw_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAI5S5_1001780
   00071 Fatty acid degradation
    SAI5S5_1001780
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAI5S5_1001780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sauw01004]
    SAI5S5_1001780
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauw04147]
    SAI5S5_1001780
Enzymes [BR:sauw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     SAI5S5_1001780
Lipid biosynthesis proteins [BR:sauw01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   SAI5S5_1001780
Exosome [BR:sauw04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   SAI5S5_1001780
  Exosomal proteins of breast cancer cells
   SAI5S5_1001780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CCJ18017
Position
complement(247984..249489)
Genome map
AA seq 501 aa AA seqDB search
MNFDWIKTRSDFDDDKPAVIDHAKQTSWTYQQLNARADNMAHYLTSQGVKKGDVIGIFAP
NDIAILDLLFACFKTGAVFLPLNWRLNPKEIAAIVEDAQLKLLFYAEKHLSSLTDIDQNL
LHMDIDVAQYDEIVNPDYHQPFQATPVEPQDLAALIYTSGTTGSPKGVMFSYESFVHNGT
NLELTYKFNSNYITIVSTPMFHVLGFNDTVLPVLMSGGTLILQRYFNGEELNDMIAQYHP
TFIIMIPTMYYSTLRASNFNPENFRAMDYIIQGGSQPLPSIQAAFKQYGINIINGYGLTE
APLVLVNTPENSKRKPMSIGKAVMFVDARILDDNGEEVPTGEIGELAIKAKNVTPGYWNK
PAETAKAFHGRYLLTGDLAKMDDDGDIFIIDRKKELIITGGENVLPSEVENALAEHPLVD
RCVVVGYDHPKYGESIAAAIILREDEPHYAEILDQHMRSRLAGYKVPRMYVPVTHMPLNS
TQKPDKLAIRQMMNDKVSQTL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgattggataaaaacgcgttcagacttcgatgatgacaagcctgccgttatt
gatcacgcaaaacaaacatcttggacataccaacaactcaatgcacgcgctgataatatg
gcacattatttaacatctcaaggtgttaaaaaaggcgatgttatcggtatttttgcgcca
aatgatattgcaatattagatttattgtttgcttgttttaaaacaggtgcggttttttta
ccattgaattggcggcttaacccaaaagaaattgcagccattgtggaagatgcacaatta
aaactgctcttctatgctgaaaaacatttaagttcactcaccgatattgaccaaaactta
ttgcatatggatattgatgtggcgcaatatgatgaaatcgtaaatccagattatcaccaa
ccttttcaagcaacacctgttgaaccacaagatcttgcagcattaatttatacaagtggt
acaaccggatcacctaaaggtgtgatgttctcatatgaatcatttgttcataacggtaca
aacttagagctgacgtacaagttcaattcaaactatattacgattgtatcaacaccaatg
ttccatgttttagggtttaacgatactgtattaccagtattaatgtcaggtggcacactt
attcttcaacgttactttaacggcgaagaattgaatgacatgattgcacaatatcaccct
acatttattatcatgattccgacaatgtattatagtacgctacgtgctagtaattttaat
cctgaaaattttagagctatggattatatcatccaaggtggttcacaaccattaccaagt
atccaagcagcttttaaacaatatggcataaacattattaacggctatggtttaactgaa
gcacctcttgtacttgttaatacaccggaaaattcaaaacgtaagccaatgagtattggt
aaagcagtcatgttcgttgatgcacgtatccttgatgataacggtgaggaagtacctact
ggtgagattggcgaacttgcaattaaggctaaaaatgtcacgccaggatattggaataaa
ccagcagagactgccaaagcatttcatggtcgttatttattaactggtgacttagcgaag
atggacgacgatggcgatatatttattattgaccgcaaaaaagaattaatcataactggt
ggcgaaaatgtcttaccatctgaagtcgaaaatgctttagctgagcatccactagtagac
cggtgtgtggtcgttggctatgatcatccaaaatatggtgaatcaattgctgcagccatt
atacttcgcgaagatgaacctcattacgctgaaattttagatcaacatatgcgaagtcgt
ttagcaggttataaagtcccaagaatgtatgtaccagtgacacatatgccgttaaacagt
acgcagaaaccagataaacttgcgattcgacaaatgatgaatgacaaagtctcacaaaca
ctttaa

DBGET integrated database retrieval system