KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1001850Help
Entry
SAI5S5_1001850    CDS       T03148                                 

Definition
(GenBank) Similar to inosine-uridine preferring nucleoside hydrolase
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-ProteinID: CCJ18024
Position
260256..261191
Genome map
AA seq 311 aa AA seqDB search
MKRKIIMDCDPGHDDAIALILAGAIDSPLEILAVTTVAGNQSVDKNTTNALNVLDIMGRQ
DIAVAKGADRPLIKPAAFASEIHGESGLDGPKLPSTPSRQAVAMPASDVIINKVMTSDTP
VTIVATGPLTNVATALIREPRIAEHIESITLMGGGTFGNWTPTAEFNIWVDAEAAKRVFE
SGITINVFGLDVTHQVLADNHVIERFESINNPVAQFVVELLQFFKKTYKTHFNMDGGPIH
DACTILYLLQPELFTMVPVNIDIEHQSPLTYGTMAVDLNHVTGKPANAYFATAVDVEEVW
NLIDHKLRTYE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaagattattatggattgtgatccaggacacgatgatgcaatagcattaatt
ttagcgggggcaattgacagtccactagagatattagctgtaacaacagtcgcaggtaat
caatcagttgacaagaatacgacaaacgccttgaacgtattggatattatgggacgccaa
gatatagcagtagcgaaaggtgcggataggccgttaattaaaccagctgcctttgcttct
gaaatacatggggaatctggattagatggtccgaaactaccgtcgacaccatcacgtcaa
gcagttgcaatgccagcatcagatgtgattataaacaaagtgatgacgagtgatacacct
gtaacaattgtagcgacaggtcctcttacgaatgtagcaacggcattgattcgtgagcca
agaatcgctgagcatattgaatctattactttgatgggtggtggtacatttggaaattgg
acgcctacagcagaattcaatatttgggtagatgctgaagcagcgaagcgtgtttttgaa
agtgggattactataaatgtgtttggtttagatgtaacacatcaagttttagccgacaat
cacgtgattgaacgctttgaaagtatcaataatcctgttgcacagttcgtcgtagaatta
ttgcaattctttaagaagacatacaagactcactttaatatggatggtggtccaatacat
gatgcttgtacaattttgtatttgttacaaccagaattgtttacaatggtacccgttaat
atcgacattgaacatcaaagtccactaacttatggcactatggctgtcgatttaaatcat
gttacaggtaagcctgccaatgcttattttgctacagcagttgatgttgaagaagtgtgg
aacttgatagaccataagttacgtacatacgaataa

DBGET integrated database retrieval system