KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1002530Help
Entry
SAI5S5_1002530    CDS       T03148                                 

Definition
(GenBank) Putative inner membrane protein
  KO
K03475  PTS system, ascorbate-specific IIC component
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Pathway
sauw00053  Ascorbate and aldarate metabolism
sauw01100  Metabolic pathways
sauw01120  Microbial metabolism in diverse environments
sauw02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    SAI5S5_1002530
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    SAI5S5_1002530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sauw02000]
    SAI5S5_1002530
Transporters [BR:sauw02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component
    SAI5S5_1002530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIC-GAT
Motif
Other DBs
NCBI-ProteinID: CCJ18092
Position
complement(350922..352268)
Genome map
AA seq 448 aa AA seqDB search
MQAILNFIVDILSQPAILVALIAFIGLIVQKKPAATITSGTIKTILGFLILSAGADVVVR
SLEPFGKIFQHAFGVQGIVPNNEAIVSLALKDFGTTAALIMVCGMIVNILIARFTNLKYI
FLTGHHTFYMAAFLAIILTVSHIKGWLTIVIGALVLGLIMAVLPALLQPTMRKITGNDQV
ALGHFGSISYFAAGAVGQLFKGKSKSTEEIKFPKGLSFLRESTISISITMALLYFIACLF
AGVSYVHESISDGQNFIVFSLIQGVTFAAGVFIILTGVRLILAEIVPAFKGISEKLVPNS
KPALDCPIVFPYAQNAVLIGFFVSFITGVIGMFILFLFGGVVILPGVVAHFFLGATAAVF
GNARGGIKGAVAGAALNGILITFLPLLFLPFLGELGGAATTFSDTDFLTVGIVFGNAVKY
MGLFGAILFIIIVGATAILLKGRQKPQQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaatccttaattttatagtcgatattttaagtcaaccagccattcttgttgca
ctgattgcctttataggtttaatcgttcagaaaaaacctgccgcaacgatcacttcagga
accattaaaacgatattaggcttcttaattttaagtgcaggtgctgatgtcgtcgttcga
tctcttgaaccattcggcaaaatattccaacacgcatttggtgtgcaaggtatcgtacct
aacaacgaagctatcgtctcactagccttaaaagattttggaacaacagctgcactcatc
atggtctgtggcatgattgttaatattttaattgctcgcttcactaatttaaaatatatc
tttttaacaggtcatcatacattttacatggctgcgtttttagcaatcattttaacagtc
agtcatattaaaggctggctaacaattgttatcggcgcactcgtattaggattaatcatg
gcagtattacctgcattactccaacctacgatgcgaaaaattacagggaatgaccaagta
gcgttaggtcattttggctcaatcagttactttgccgcaggtgctgtaggtcaattattc
aaaggtaagtctaaatcaacggaagagattaaatttccaaaaggcttaagtttcttacga
gaaagtacaattagtatctcgattacaatggcattactttacttcatcgcatgcttattt
gcgggcgttagttatgtacacgaatctattagtgatggtcaaaactttattgtcttttct
ttaattcaaggtgtgacatttgctgctggtgtatttattattttaacgggcgttcgttta
atcttagctgaaatcgtcccagcatttaaaggaatttctgaaaagcttgtaccaaattct
aaacctgcattagactgccctattgtgttcccttatgcacaaaatgcagtattaattgga
ttctttgtcagctttattacaggtgtcatcggtatgtttatcttattcttatttggtggc
gtcgtcattttacctggcgtagttgcacacttcttcttaggtgcaacggctgctgtattc
ggtaatgcaagaggcggtattaaaggtgctgttgctggcgccgctctaaatggtatccta
atcacgtttttaccattattattcttgccatttttaggcgaattaggtggtgctgcaaca
acattctcagatacagactttttaactgtcggtatcgtgttcggtaacgcagtaaaatat
atgggattatttggtgcgattctatttattattatcgtaggtgcgacagcaattttatta
aaaggccgtcaaaagccacagcaatag

DBGET integrated database retrieval system