KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1004420Help
Entry
SAI5S5_1004420    CDS       T03148                                 

Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase vraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Pathway
sauw00071  Fatty acid degradation
sauw00072  Synthesis and degradation of ketone bodies
sauw00280  Valine, leucine and isoleucine degradation
sauw00310  Lysine degradation
sauw00362  Benzoate degradation
sauw00380  Tryptophan metabolism
sauw00620  Pyruvate metabolism
sauw00630  Glyoxylate and dicarboxylate metabolism
sauw00640  Propanoate metabolism
sauw00650  Butanoate metabolism
sauw00900  Terpenoid backbone biosynthesis
sauw01100  Metabolic pathways
sauw01110  Biosynthesis of secondary metabolites
sauw01120  Microbial metabolism in diverse environments
sauw01130  Biosynthesis of antibiotics
sauw01200  Carbon metabolism
sauw01212  Fatty acid metabolism
sauw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAI5S5_1004420
   00630 Glyoxylate and dicarboxylate metabolism
    SAI5S5_1004420
   00640 Propanoate metabolism
    SAI5S5_1004420
   00650 Butanoate metabolism
    SAI5S5_1004420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAI5S5_1004420
   00072 Synthesis and degradation of ketone bodies
    SAI5S5_1004420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI5S5_1004420
   00310 Lysine degradation
    SAI5S5_1004420
   00380 Tryptophan metabolism
    SAI5S5_1004420
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAI5S5_1004420
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAI5S5_1004420
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAI5S5_1004420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauw04147]
    SAI5S5_1004420
Enzymes [BR:sauw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAI5S5_1004420
Exosome [BR:sauw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAI5S5_1004420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCJ18267
Position
606258..607397
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system